Recombinant Human PROK2 protein, His-tagged
Cat.No. : | PROK2-3663H |
Product Overview : | Recombinant Human PROK2 protein(32-106 aa), fused to His tag, was expressed in E. coli. |
Availability | July 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 32-106 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHT |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PROK2 prokineticin 2 [ Homo sapiens ] |
Official Symbol | PROK2 |
Synonyms | PROK2; prokineticin 2; prokineticin-2; BV8; KAL4; MIT1; PK2; protein Bv8 homolog; |
Gene ID | 60675 |
mRNA Refseq | NM_001126128 |
Protein Refseq | NP_001119600 |
MIM | 607002 |
UniProt ID | Q9HC23 |
◆ Recombinant Proteins | ||
Prok2-545M | Recombinant Mouse Prok2 protein, His-B2M-tagged | +Inquiry |
PROK2-767H | Recombinant Human PROK2 protein, His & GST-tagged | +Inquiry |
PROK2-412H | Recombinant Human PROK2 Protein | +Inquiry |
PROK2-6188H | Recombinant Human PROK2 Protein (Ile30-Gln128), N-GST tagged | +Inquiry |
PROK2-13431M | Recombinant Mouse PROK2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PROK2-2835HCL | Recombinant Human PROK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PROK2 Products
Required fields are marked with *
My Review for All PROK2 Products
Required fields are marked with *