Recombinant Human PROSC protein, GST-tagged
Cat.No. : | PROSC-3252H |
Product Overview : | Recombinant Human PROSC protein(1-275 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-275 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MWRAGSMSAELGVGCALRAVNERVQQAVARRPRDLPAIQPRLVAVSKTKPADMVIEAYGHGQRTFGENYVQELLEKASNPKILSLCPEIKWHFIGHLQKQNVNKLMAVPNLFMLETVDSVKLADKVNSSWQRKGSPERLKVMVQINTSGEESKHGLPPSETIAIVEHINAKCPNLEFVGLMTIGSFGHDLSQGPNPDFQLLLSLREELCKKLNIPADQVELSMGMSADFQHAVEVGSTNVRIGSTIFGERDYSKKPTPDKCAADVKAPLEVAQEH |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | PROSC proline synthetase co-transcribed homolog (bacterial) [ Homo sapiens ] |
Official Symbol | PROSC |
Synonyms | PROSC; proline synthetase co-transcribed homolog (bacterial); proline synthetase co transcribed (bacterial homolog); proline synthase co-transcribed bacterial homolog protein; proline synthetase co-transcribed (bacterial homolog); proline synthetase co-transcribed bacterial homolog protein; FLJ11861; |
Gene ID | 11212 |
mRNA Refseq | NM_007198 |
Protein Refseq | NP_009129 |
MIM | 604436 |
UniProt ID | O94903 |
◆ Recombinant Proteins | ||
PROSC-6723Z | Recombinant Zebrafish PROSC | +Inquiry |
PROSC-138H | Recombinant Full Length Human PROSC Protein, His-tagged | +Inquiry |
PROSC-3252H | Recombinant Human PROSC protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PROSC-2831HCL | Recombinant Human PROSC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PROSC Products
Required fields are marked with *
My Review for All PROSC Products
Required fields are marked with *