Recombinant Human PRPS2 protein, T7/His-tagged
| Cat.No. : | PRPS2-189H | 
| Product Overview : | Recombinant human PRPS2 (317aa, Isoform-2, derived from BC110875) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&T7 | 
| Protein Length : | 319 a.a. | 
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT. | 
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGES VRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGAD HIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERK KANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVT NTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL | 
| Purity : | >90% by SDS-PAGE | 
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. | 
| Gene Name | PRPS2 phosphoribosyl pyrophosphate synthetase 2 [ Homo sapiens ] | 
| Official Symbol | PRPS2 | 
| Synonyms | PRPS2; phosphoribosyl pyrophosphate synthetase 2; ribose-phosphate pyrophosphokinase 2; PRS II; ribose phosphate diphosphokinase 2; PRS-II; PPRibP synthetase; ribose-phosphate diphosphokinase 2; phosphoribosyl pyrophosphate synthase II; PRSII; | 
| Gene ID | 5634 | 
| mRNA Refseq | NM_001039091 | 
| Protein Refseq | NP_001034180 | 
| MIM | 311860 | 
| UniProt ID | P11908 | 
| Chromosome Location | Xpter-q21 | 
| Pathway | 5-Phosphoribose 1-diphosphate biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem; Nucleotide Metabolism, organism-specific biosystem; PRPP biosynthesis I, organism-specific biosystem; PRPP biosynthesis, ribose 5P => | 
| Function | ATP binding; kinase activity; magnesium ion binding; nucleotide binding; protein homodimerization activity; ribose phosphate diphosphokinase activity; transferase activity; | 
| ◆ Recombinant Proteins | ||
| PRPS2-189H | Recombinant Human PRPS2 protein, T7/His-tagged | +Inquiry | 
| PRPS2-4383R | Recombinant Rat PRPS2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| PRPS2-5743H | Recombinant Human PRPS2 protein, His-tagged | +Inquiry | 
| PRPS2-4724R | Recombinant Rat PRPS2 Protein | +Inquiry | 
| PRPS2-3750H | Recombinant Human PRPS2 protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| PRPS2-505HCL | Recombinant Human PRPS2 lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All PRPS2 Products
Required fields are marked with *
My Review for All PRPS2 Products
Required fields are marked with *
  
        
    
      
            