Recombinant Human PRPS2 protein, T7/His-tagged
Cat.No. : | PRPS2-189H |
Product Overview : | Recombinant human PRPS2 (317aa, Isoform-2, derived from BC110875) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 319 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGES VRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGAD HIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERK KANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVT NTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | PRPS2 phosphoribosyl pyrophosphate synthetase 2 [ Homo sapiens ] |
Official Symbol | PRPS2 |
Synonyms | PRPS2; phosphoribosyl pyrophosphate synthetase 2; ribose-phosphate pyrophosphokinase 2; PRS II; ribose phosphate diphosphokinase 2; PRS-II; PPRibP synthetase; ribose-phosphate diphosphokinase 2; phosphoribosyl pyrophosphate synthase II; PRSII; |
Gene ID | 5634 |
mRNA Refseq | NM_001039091 |
Protein Refseq | NP_001034180 |
MIM | 311860 |
UniProt ID | P11908 |
Chromosome Location | Xpter-q21 |
Pathway | 5-Phosphoribose 1-diphosphate biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem; Nucleotide Metabolism, organism-specific biosystem; PRPP biosynthesis I, organism-specific biosystem; PRPP biosynthesis, ribose 5P => |
Function | ATP binding; kinase activity; magnesium ion binding; nucleotide binding; protein homodimerization activity; ribose phosphate diphosphokinase activity; transferase activity; |
◆ Recombinant Proteins | ||
PRPS2-181H | Recombinant Human PRPS2, His-tagged | +Inquiry |
PRPS2-3030H | Recombinant Human PRPS2 Protein, MYC/DDK-tagged | +Inquiry |
PRPS2-1411C | Recombinant Chicken PRPS2 | +Inquiry |
Prps2-479M | Recombinant Mouse Prps2 Protein, MYC/DDK-tagged | +Inquiry |
PRPS2-374H | Recombinant Human PRPS2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRPS2-505HCL | Recombinant Human PRPS2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRPS2 Products
Required fields are marked with *
My Review for All PRPS2 Products
Required fields are marked with *
0
Inquiry Basket