Recombinant Human PRPS2 protein, T7/His-tagged

Cat.No. : PRPS2-189H
Product Overview : Recombinant human PRPS2 (317aa, Isoform-2, derived from BC110875) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 319 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGES VRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGAD HIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERK KANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVT NTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name PRPS2 phosphoribosyl pyrophosphate synthetase 2 [ Homo sapiens ]
Official Symbol PRPS2
Synonyms PRPS2; phosphoribosyl pyrophosphate synthetase 2; ribose-phosphate pyrophosphokinase 2; PRS II; ribose phosphate diphosphokinase 2; PRS-II; PPRibP synthetase; ribose-phosphate diphosphokinase 2; phosphoribosyl pyrophosphate synthase II; PRSII;
Gene ID 5634
mRNA Refseq NM_001039091
Protein Refseq NP_001034180
MIM 311860
UniProt ID P11908
Chromosome Location Xpter-q21
Pathway 5-Phosphoribose 1-diphosphate biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem; Nucleotide Metabolism, organism-specific biosystem; PRPP biosynthesis I, organism-specific biosystem; PRPP biosynthesis, ribose 5P =>
Function ATP binding; kinase activity; magnesium ion binding; nucleotide binding; protein homodimerization activity; ribose phosphate diphosphokinase activity; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRPS2 Products

Required fields are marked with *

My Review for All PRPS2 Products

Required fields are marked with *

0
cart-icon
0
compare icon