Recombinant Human PRPSAP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PRPSAP2-547H |
Product Overview : | PRPSAP2 MS Standard C13 and N15-labeled recombinant protein (NP_002758) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein that associates with the enzyme phosphoribosylpyrophosphate synthetase (PRS). PRS catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD. PRS exists as a complex with two catalytic subunits and two associated subunits. This gene encodes a non-catalytic associated subunit of PRS. Alternate splicing results in multiple transcript variants. |
Molecular Mass : | 40.9 kDa |
AA Sequence : | MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PRPSAP2 phosphoribosyl pyrophosphate synthetase-associated protein 2 [ Homo sapiens (human) ] |
Official Symbol | PRPSAP2 |
Synonyms | PRPSAP2; phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphoribosyl pyrophosphate synthase-associated protein 2; PAP41; PRPP synthase-associated protein 2; 41 kDa phosphoribosypyrophosphate synthetase-associated protein; MGC117304; MGC126719; MGC126721; |
Gene ID | 5636 |
mRNA Refseq | NM_002767 |
Protein Refseq | NP_002758 |
MIM | 603762 |
UniProt ID | O60256 |
◆ Recombinant Proteins | ||
PRPSAP2-12659Z | Recombinant Zebrafish PRPSAP2 | +Inquiry |
PRPSAP2-547H | Recombinant Human PRPSAP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Prpsap2-5154M | Recombinant Mouse Prpsap2 Protein, Myc/DDK-tagged | +Inquiry |
PRPSAP2-1985H | Recombinant Human PRPSAP2, GST-tagged | +Inquiry |
PRPSAP2-4384R | Recombinant Rat PRPSAP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRPSAP2-2818HCL | Recombinant Human PRPSAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRPSAP2 Products
Required fields are marked with *
My Review for All PRPSAP2 Products
Required fields are marked with *