Recombinant Human PRPSAP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PRPSAP2-547H |
| Product Overview : | PRPSAP2 MS Standard C13 and N15-labeled recombinant protein (NP_002758) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a protein that associates with the enzyme phosphoribosylpyrophosphate synthetase (PRS). PRS catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD. PRS exists as a complex with two catalytic subunits and two associated subunits. This gene encodes a non-catalytic associated subunit of PRS. Alternate splicing results in multiple transcript variants. |
| Molecular Mass : | 40.9 kDa |
| AA Sequence : | MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PRPSAP2 phosphoribosyl pyrophosphate synthetase-associated protein 2 [ Homo sapiens (human) ] |
| Official Symbol | PRPSAP2 |
| Synonyms | PRPSAP2; phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphoribosyl pyrophosphate synthase-associated protein 2; PAP41; PRPP synthase-associated protein 2; 41 kDa phosphoribosypyrophosphate synthetase-associated protein; MGC117304; MGC126719; MGC126721; |
| Gene ID | 5636 |
| mRNA Refseq | NM_002767 |
| Protein Refseq | NP_002758 |
| MIM | 603762 |
| UniProt ID | O60256 |
| ◆ Recombinant Proteins | ||
| PRPSAP2-12659Z | Recombinant Zebrafish PRPSAP2 | +Inquiry |
| PRPSAP2-1985H | Recombinant Human PRPSAP2, GST-tagged | +Inquiry |
| PRPSAP2-1316C | Recombinant Chicken PRPSAP2 | +Inquiry |
| PRPSAP2-2461H | Recombinant human PRPSAP2, His-tagged | +Inquiry |
| PRPSAP2-547H | Recombinant Human PRPSAP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRPSAP2-2818HCL | Recombinant Human PRPSAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRPSAP2 Products
Required fields are marked with *
My Review for All PRPSAP2 Products
Required fields are marked with *



