Recombinant Human PRR15 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PRR15-1320H
• Product Overview: PRR15 MS Standard C13 and N15-labeled recombinant protein (NP_787083) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: PRR15 (Proline Rich 15) is a Protein Coding gene. Diseases associated with PRR15 include Glioblastoma Proneural Subtype. An important paralog of this gene is PRR15L.
• Molecular Mass: 13.7 kDa
• AA Sequence: MADSGDAGSSGPWWKSLTNSRKKSKEAAVGVPPPAQPAPGEPTPPAPPSPDWTSSSRENQHPNLLGGAGEPPKPDKLYGDKSGSSRRNLKISRSGRFKEKRKVRATLLPEAGRSPEEAGFPGDPHEDKQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PRR15 proline rich 15 [ Homo sapiens (human) ]
• Official Symbol: PRR15
• Synonyms: PRR15; proline rich 15; proline-rich protein 15
• Gene ID: 222171
• mRNA Refseq: NM_175887
• Protein Refseq: NP_787083
• MIM: 618344
• UniProt ID: Q8IV56