Recombinant Human PRR20D Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PRR20D-560H |
Product Overview : | PRR20D MS Standard C13 and N15-labeled recombinant protein (NP_001123878) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is one of five identical loci in a cluster on chromosome 13q21.1. The predicted protein is proline-rich and contains several dopamine D4 receptor signatures and PRINTS domains. |
Molecular Mass : | 23.1 kDa |
AA Sequence : | MEEPRPSKRLRSMAPNQASGGPPPEPGCCVADPEGSVEADGPAQPAQPAKPIAYVKPFRRQPPARPESPPPAERGRRRGGSRRPGRGRGRRAGPRGDAGQRQGAEGLMAPDVHIQLDHHGEPGHQGEPEITETAAFSLSETGPPPGTVQEGPGPDVAQPELGFQEPPAAPGPQAVDWQPVLTLYPCIGFRALGDSAVLQVIQTPQGTYVQGVPVFLTDIAYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PRR20D proline rich 20D [ Homo sapiens (human) ] |
Official Symbol | PRR20D |
Synonyms | PRR20D; proline rich 20D; PRR20; PRR20A; PRR20B; PRR20C; PRR20E; proline-rich protein 20D; FLJ40296 protein family member; Proline-rich protein 20A; Proline-rich protein 20B; Proline-rich protein 20C; Proline-rich protein 20E |
Gene ID | 729246 |
mRNA Refseq | NM_001130406 |
Protein Refseq | NP_001123878 |
UniProt ID | P86478 |
◆ Recombinant Proteins | ||
PRR20D-560H | Recombinant Human PRR20D Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRR20D-3025H | Recombinant Human PRR20D Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRR20D Products
Required fields are marked with *
My Review for All PRR20D Products
Required fields are marked with *