Recombinant Human PRR20D Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PRR20D-560H
Product Overview : PRR20D MS Standard C13 and N15-labeled recombinant protein (NP_001123878) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is one of five identical loci in a cluster on chromosome 13q21.1. The predicted protein is proline-rich and contains several dopamine D4 receptor signatures and PRINTS domains.
Molecular Mass : 23.1 kDa
AA Sequence : MEEPRPSKRLRSMAPNQASGGPPPEPGCCVADPEGSVEADGPAQPAQPAKPIAYVKPFRRQPPARPESPPPAERGRRRGGSRRPGRGRGRRAGPRGDAGQRQGAEGLMAPDVHIQLDHHGEPGHQGEPEITETAAFSLSETGPPPGTVQEGPGPDVAQPELGFQEPPAAPGPQAVDWQPVLTLYPCIGFRALGDSAVLQVIQTPQGTYVQGVPVFLTDIAYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PRR20D proline rich 20D [ Homo sapiens (human) ]
Official Symbol PRR20D
Synonyms PRR20D; proline rich 20D; PRR20; PRR20A; PRR20B; PRR20C; PRR20E; proline-rich protein 20D; FLJ40296 protein family member; Proline-rich protein 20A; Proline-rich protein 20B; Proline-rich protein 20C; Proline-rich protein 20E
Gene ID 729246
mRNA Refseq NM_001130406
Protein Refseq NP_001123878
UniProt ID P86478

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRR20D Products

Required fields are marked with *

My Review for All PRR20D Products

Required fields are marked with *

0
cart-icon