Recombinant Human PRR20D Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PRR20D-560H
• Product Overview: PRR20D MS Standard C13 and N15-labeled recombinant protein (NP_001123878) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene is one of five identical loci in a cluster on chromosome 13q21.1. The predicted protein is proline-rich and contains several dopamine D4 receptor signatures and PRINTS domains.
• Molecular Mass: 23.1 kDa
• AA Sequence: MEEPRPSKRLRSMAPNQASGGPPPEPGCCVADPEGSVEADGPAQPAQPAKPIAYVKPFRRQPPARPESPPPAERGRRRGGSRRPGRGRGRRAGPRGDAGQRQGAEGLMAPDVHIQLDHHGEPGHQGEPEITETAAFSLSETGPPPGTVQEGPGPDVAQPELGFQEPPAAPGPQAVDWQPVLTLYPCIGFRALGDSAVLQVIQTPQGTYVQGVPVFLTDIAYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PRR20D proline rich 20D [ Homo sapiens (human) ]
• Official Symbol: PRR20D
• Synonyms: PRR20D; proline rich 20D; PRR20; PRR20A; PRR20B; PRR20C; PRR20E; proline-rich protein 20D; FLJ40296 protein family member; Proline-rich protein 20A; Proline-rich protein 20B; Proline-rich protein 20C; Proline-rich protein 20E
• Gene ID: 729246
• mRNA Refseq: NM_001130406
• Protein Refseq: NP_001123878
• UniProt ID: P86478