Recombinant Human PRRX1
| Cat.No. : | PRRX1-30707TH |
| Product Overview : | Recombinant fragment of Human PRRX1 with an N terminal proprietary tag; Predicted MWt 35.53 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 90 amino acids |
| Description : | The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns. |
| Molecular Weight : | 35.530kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKK |
| Sequence Similarities : | Belongs to the paired homeobox family.Contains 1 homeobox DNA-binding domain. |
| Gene Name | PRRX1 paired related homeobox 1 [ Homo sapiens ] |
| Official Symbol | PRRX1 |
| Synonyms | PRRX1; paired related homeobox 1; paired mesoderm homeo box 1 , PMX1; paired mesoderm homeobox protein 1; PHOX1; |
| Gene ID | 5396 |
| mRNA Refseq | NM_006902 |
| Protein Refseq | NP_008833 |
| MIM | 167420 |
| Uniprot ID | P54821 |
| Chromosome Location | 1q24.3 |
| Function | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity; |
| ◆ Recombinant Proteins | ||
| PRRX1-30707TH | Recombinant Human PRRX1 | +Inquiry |
| PRRX1-5096C | Recombinant Chicken PRRX1 | +Inquiry |
| PRRX1-4735R | Recombinant Rat PRRX1 Protein | +Inquiry |
| Prrx1-5162M | Recombinant Mouse Prrx1 Protein, Myc/DDK-tagged | +Inquiry |
| PRRX1-31000TH | Recombinant Human PRRX1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRRX1-2807HCL | Recombinant Human PRRX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRRX1 Products
Required fields are marked with *
My Review for All PRRX1 Products
Required fields are marked with *
