Recombinant Human PRRX1

Cat.No. : PRRX1-30707TH
Product Overview : Recombinant fragment of Human PRRX1 with an N terminal proprietary tag; Predicted MWt 35.53 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns.
Molecular Weight : 35.530kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKK
Sequence Similarities : Belongs to the paired homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name PRRX1 paired related homeobox 1 [ Homo sapiens ]
Official Symbol PRRX1
Synonyms PRRX1; paired related homeobox 1; paired mesoderm homeo box 1 , PMX1; paired mesoderm homeobox protein 1; PHOX1;
Gene ID 5396
mRNA Refseq NM_006902
Protein Refseq NP_008833
MIM 167420
Uniprot ID P54821
Chromosome Location 1q24.3
Function sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRRX1 Products

Required fields are marked with *

My Review for All PRRX1 Products

Required fields are marked with *

0
cart-icon