Recombinant Human PRRX1 protein(11-80 aa), C-His-tagged
Cat.No. : | PRRX1-2787H |
Product Overview : | Recombinant Human PRRX1 protein(P54821)(11-80 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 11-80 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | RQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQD |
Gene Name | PRRX1 paired related homeobox 1 [ Homo sapiens ] |
Official Symbol | PRRX1 |
Synonyms | PRRX1; paired related homeobox 1; paired mesoderm homeo box 1 , PMX1; paired mesoderm homeobox protein 1; PHOX1; PRX-1; homeobox protein PHOX1; paired mesoderm homeo box 1; paired-related homeobox protein 1; paired mesoderm homeobox 1 isoform pmx-1b; PMX1; PRX1; AGOTC; |
Gene ID | 5396 |
mRNA Refseq | NM_006902 |
Protein Refseq | NP_008833 |
MIM | 167420 |
UniProt ID | P54821 |
◆ Recombinant Proteins | ||
PRRX1-5096C | Recombinant Chicken PRRX1 | +Inquiry |
PRRX1-4394R | Recombinant Rat PRRX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRRX1-1747C | Recombinant Chicken PRRX1 | +Inquiry |
PRRX1-31000TH | Recombinant Human PRRX1 | +Inquiry |
PRRX1-3924H | Recombinant Human PRRX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRRX1-2807HCL | Recombinant Human PRRX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRRX1 Products
Required fields are marked with *
My Review for All PRRX1 Products
Required fields are marked with *