Recombinant Human PRRX1 protein(11-80 aa), C-His-tagged
| Cat.No. : | PRRX1-2787H |
| Product Overview : | Recombinant Human PRRX1 protein(P54821)(11-80 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 11-80 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | RQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQD |
| Gene Name | PRRX1 paired related homeobox 1 [ Homo sapiens ] |
| Official Symbol | PRRX1 |
| Synonyms | PRRX1; paired related homeobox 1; paired mesoderm homeo box 1 , PMX1; paired mesoderm homeobox protein 1; PHOX1; PRX-1; homeobox protein PHOX1; paired mesoderm homeo box 1; paired-related homeobox protein 1; paired mesoderm homeobox 1 isoform pmx-1b; PMX1; PRX1; AGOTC; |
| Gene ID | 5396 |
| mRNA Refseq | NM_006902 |
| Protein Refseq | NP_008833 |
| MIM | 167420 |
| UniProt ID | P54821 |
| ◆ Recombinant Proteins | ||
| PRRX1-31000TH | Recombinant Human PRRX1 | +Inquiry |
| PRRX1-3924H | Recombinant Human PRRX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRRX1-427HF | Recombinant Full Length Human PRRX1 Protein | +Inquiry |
| PRRX1-5096C | Recombinant Chicken PRRX1 | +Inquiry |
| PRRX1-30707TH | Recombinant Human PRRX1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRRX1-2807HCL | Recombinant Human PRRX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRRX1 Products
Required fields are marked with *
My Review for All PRRX1 Products
Required fields are marked with *



