Recombinant Human PRSS1 protein, Fc/His-tagged

Cat.No. : PRSS1-5894H
Product Overview : Recombinant Human PRSS1(Ala16-Ser247) fused with Fc/His tag at C-terminal was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc&His
Protein Length : Ala16-Ser247
Description : Trypsin-1, also known as Beta-trypsin, Cationic trypsinogen, Serine protease 1, Trypsin I, TRP1, TRY1, TRY4, TRYP1 and PRSS1, is a member of the trypsin family of serine proteases. PRSS1 contains one peptidase S1 domain and binds one calcium ion per subunit. PRSS1 is secreted by the pancreas and cleaved to its active form in the small intestine. Trypsin-1 is active on peptide linkages involving the carboxyl group of lysine or arginine. Defects in PRSS1 are a cause of pancreatitis (PCTT), which characterized by the presence of calculi in pancreatic ducts.
Form : Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Molecular Mass : 52.9 kDa
AA Sequence : APFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINA AKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAP VLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWI KNTIAANSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Please minimize freeze-thaw cycles.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name PRSS1 protease, serine, 1 (trypsin 1) [ Homo sapiens ]
Official Symbol PRSS1
Synonyms PRSS1; protease, serine, 1 (trypsin 1); TRY1; trypsin-1; beta-trypsin; trypsinogen 1; trypsinogen A; digestive zymogen; cationic trypsinogen; nonfunctional trypsin 1; TRP1; TRY4; TRYP1; FLJ57296; MGC120175; MGC149362; DKFZp779A0837;
Gene ID 5644
mRNA Refseq NM_002769
Protein Refseq NP_002760
MIM 276000
UniProt ID P07477
Chromosome Location 7q34
Pathway Activation of Matrix Metalloproteinases, organism-specific biosystem; Degradation of the extracellular matrix, organism-specific biosystem; Extracellular matrix organization, organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem;
Function metal ion binding; peptidase activity; serine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRSS1 Products

Required fields are marked with *

My Review for All PRSS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon