Recombinant Human PRSS1 protein, Fc/His-tagged
| Cat.No. : | PRSS1-5894H |
| Product Overview : | Recombinant Human PRSS1(Ala16-Ser247) fused with Fc/His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc&His |
| Protein Length : | Ala16-Ser247 |
| Description : | Trypsin-1, also known as Beta-trypsin, Cationic trypsinogen, Serine protease 1, Trypsin I, TRP1, TRY1, TRY4, TRYP1 and PRSS1, is a member of the trypsin family of serine proteases. PRSS1 contains one peptidase S1 domain and binds one calcium ion per subunit. PRSS1 is secreted by the pancreas and cleaved to its active form in the small intestine. Trypsin-1 is active on peptide linkages involving the carboxyl group of lysine or arginine. Defects in PRSS1 are a cause of pancreatitis (PCTT), which characterized by the presence of calculi in pancreatic ducts. |
| Form : | Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2. |
| Molecular Mass : | 52.9 kDa |
| AA Sequence : | APFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINA AKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAP VLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWI KNTIAANSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| Storage : | Please minimize freeze-thaw cycles. |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | PRSS1 protease, serine, 1 (trypsin 1) [ Homo sapiens ] |
| Official Symbol | PRSS1 |
| Synonyms | PRSS1; protease, serine, 1 (trypsin 1); TRY1; trypsin-1; beta-trypsin; trypsinogen 1; trypsinogen A; digestive zymogen; cationic trypsinogen; nonfunctional trypsin 1; TRP1; TRY4; TRYP1; FLJ57296; MGC120175; MGC149362; DKFZp779A0837; |
| Gene ID | 5644 |
| mRNA Refseq | NM_002769 |
| Protein Refseq | NP_002760 |
| MIM | 276000 |
| UniProt ID | P07477 |
| Chromosome Location | 7q34 |
| Pathway | Activation of Matrix Metalloproteinases, organism-specific biosystem; Degradation of the extracellular matrix, organism-specific biosystem; Extracellular matrix organization, organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem; |
| Function | metal ion binding; peptidase activity; serine-type endopeptidase activity; |
| ◆ Recombinant Proteins | ||
| PRSS1-3453R | Recombinant Rhesus Macaque PRSS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRSS1-3373H | Recombinant Human PRSS1 protein, His&Myc-tagged | +Inquiry |
| Prss1-3466R | Recombinant Rat Prss1, His-tagged | +Inquiry |
| PRSS1-6015H | Recombinant Human PRSS1 Protein (Ala16-Ser247), C-His and Fc tagged | +Inquiry |
| PRSS1-1494R | Recombinant Rat PRSS1 Protein (24–246 aa), His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| PRSS1-30745TH | Active Native Human PRSS1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRSS1-2806HCL | Recombinant Human PRSS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRSS1 Products
Required fields are marked with *
My Review for All PRSS1 Products
Required fields are marked with *
