Recombinant Human PRSS1 protein, His&Myc-tagged
| Cat.No. : | PRSS1-3373H |
| Product Overview : | Recombinant Human PRSS1 protein(P07477)(24-247aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 24-247aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 31.6 kDa |
| AA Sequence : | IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PRSS1 protease, serine, 1 (trypsin 1) [ Homo sapiens ] |
| Official Symbol | PRSS1 |
| Synonyms | PRSS1; protease, serine, 1 (trypsin 1); TRY1; trypsin-1; beta-trypsin; trypsinogen 1; trypsinogen A; digestive zymogen; cationic trypsinogen; nonfunctional trypsin 1; TRP1; TRY4; TRYP1; FLJ57296; MGC120175; MGC149362; DKFZp779A0837; |
| Gene ID | 5644 |
| mRNA Refseq | NM_002769 |
| Protein Refseq | NP_002760 |
| MIM | 276000 |
| UniProt ID | P07477 |
| ◆ Recombinant Proteins | ||
| PRSS1-4396R | Recombinant Rat PRSS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRSS1-6014H | Recombinant Human PRSS1 Protein (Ile24-Ser247), His tagged | +Inquiry |
| Prss1-1991R | Recombinant Rat Prss1 Protein, His-tagged | +Inquiry |
| PRSS1-3373H | Recombinant Human PRSS1 protein, His&Myc-tagged | +Inquiry |
| PRSS1-3635R | Recombinant Rhesus monkey PRSS1 Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| PRSS1-30745TH | Active Native Human PRSS1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRSS1-2806HCL | Recombinant Human PRSS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRSS1 Products
Required fields are marked with *
My Review for All PRSS1 Products
Required fields are marked with *
