Recombinant Human PRSS1 protein, His&Myc-tagged

Cat.No. : PRSS1-3373H
Product Overview : Recombinant Human PRSS1 protein(P07477)(24-247aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 24-247aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 31.6 kDa
AA Sequence : IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name PRSS1 protease, serine, 1 (trypsin 1) [ Homo sapiens ]
Official Symbol PRSS1
Synonyms PRSS1; protease, serine, 1 (trypsin 1); TRY1; trypsin-1; beta-trypsin; trypsinogen 1; trypsinogen A; digestive zymogen; cationic trypsinogen; nonfunctional trypsin 1; TRP1; TRY4; TRYP1; FLJ57296; MGC120175; MGC149362; DKFZp779A0837;
Gene ID 5644
mRNA Refseq NM_002769
Protein Refseq NP_002760
MIM 276000
UniProt ID P07477

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRSS1 Products

Required fields are marked with *

My Review for All PRSS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon