Recombinant Human PRSS3 protein, His-tagged
| Cat.No. : | PRSS3-3966H |
| Product Overview : | Recombinant Human PRSS3 protein(P35030)(81-303aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 81-303aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 28.2 kDa |
| AA Sequence : | IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PRSS3 protease, serine, 3 [ Homo sapiens ] |
| Official Symbol | PRSS3 |
| Synonyms | PRSS3; protease, serine, 3; protease, serine, 3 (mesotrypsin) , protease, serine, 4 (trypsin 4, brain) , PRSS4; trypsin-3; mesotrypsin; TRY3; TRY4; trypsin IV; trypsin III; trypsinogen 4; trypsinogen 5; trypsinogen IV; mesotrypsinogen; brain trypsinogen; pancreatic trypsinogen III; protease, serine, 4 (trypsin 4, brain); T9; MTG; PRSS4; |
| Gene ID | 5646 |
| mRNA Refseq | NM_001197097 |
| Protein Refseq | NP_001184026 |
| MIM | 613578 |
| UniProt ID | P35030 |
| ◆ Recombinant Proteins | ||
| PRSS3-4401R | Recombinant Rat PRSS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRSS3-4742R | Recombinant Rat PRSS3 Protein | +Inquiry |
| PRSS3-226H | Recombinant Human PRSS3 protein, T7/His-tagged | +Inquiry |
| PRSS3-517H | Recombinant Human PRSS3 Protein, His-tagged, Active | +Inquiry |
| PRSS3-375H | Recombinant Human PRSS3 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRSS3-2046HCL | Recombinant Human PRSS3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRSS3 Products
Required fields are marked with *
My Review for All PRSS3 Products
Required fields are marked with *
