Recombinant Human PRSS3 protein, T7/His-tagged

Cat.No. : PRSS3-226H
Product Overview : Recombinant human Trypsin-3 cDNA (81 – 304 aa, derived from BC069476) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 81-304 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFELIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKT RIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLIS GWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWG HGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro PRSS3 protein mediated pancreatic cancer cell differentiation and metastasis regulation study with this protein as either coating matrix protein or as soluble factor.2. May be used for PPSS3 protein – protein interaction assay.3. May be used for specific antibody production.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name PRSS3 protease, serine, 3 [ Homo sapiens ]
Official Symbol PRSS3
Synonyms PRSS3; protease, serine, 3; protease, serine, 3 (mesotrypsin) , protease, serine, 4 (trypsin 4, brain) , PRSS4; trypsin-3; mesotrypsin; TRY3; TRY4; trypsin IV; trypsin III; trypsinogen 4; trypsinogen 5; trypsinogen IV; mesotrypsinogen; brain trypsinogen; pancreatic trypsinogen III; protease, serine, 4 (trypsin 4, brain); T9; MTG; PRSS4;
Gene ID 5646
mRNA Refseq NM_001197097
Protein Refseq NP_001184026
MIM 613578
UniProt ID P35030
Chromosome Location 9p13
Pathway Alpha-defensins, organism-specific biosystem; Defensins, organism-specific biosystem; Immune System, organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; Innate Immune System, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem;
Function calcium ion binding; peptidase activity; protein binding; serine-type endopeptidase activity; serine-type peptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRSS3 Products

Required fields are marked with *

My Review for All PRSS3 Products

Required fields are marked with *

0
cart-icon