"PRSS3" Related Products

Expand
Expand
Expand

Recombinant Human PRSS3 protein, T7/His-tagged

Cat.No.: PRSS3-226H
Product Overview: Recombinant human Trypsin-3 cDNA (81 – 304 aa, derived from BC069476) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFELIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKT RIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLIS GWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWG HGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro PRSS3 protein mediated pancreatic cancer cell differentiation and metastasis regulation study with this protein as either coating matrix protein or as soluble factor.2. May be used for PPSS3 protein – protein interaction assay.3. May be used for specific antibody production.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: PRSS3 protease, serine, 3 [ Homo sapiens ]
Official Symbol: PRSS3
Synonyms: PRSS3; protease, serine, 3; protease, serine, 3 (mesotrypsin) , protease, serine, 4 (trypsin 4, brain) , PRSS4; trypsin-3; mesotrypsin; TRY3; TRY4; trypsin IV; trypsin III; trypsinogen 4; trypsinogen 5; trypsinogen IV; mesotrypsinogen; brain trypsinogen; pancreatic trypsinogen III; protease, serine, 4 (trypsin 4, brain); T9; MTG; PRSS4;
Gene ID: 5646
mRNA Refseq: NM_001197097
Protein Refseq: NP_001184026
MIM: 613578
UniProt ID: P35030
Chromosome Location: 9p13
Pathway: Alpha-defensins, organism-specific biosystem; Defensins, organism-specific biosystem; Immune System, organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; Innate Immune System, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem;
Function: calcium ion binding; peptidase activity; protein binding; serine-type endopeptidase activity; serine-type peptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.