Recombinant Human PRSS3 protein, T7/His-tagged
| Cat.No. : | PRSS3-226H |
| Product Overview : | Recombinant human Trypsin-3 cDNA (81 – 304 aa, derived from BC069476) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 81-304 a.a. |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFELIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKT RIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLIS GWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWG HGCAWKNRPGVYTKVYNYVDWIKDTIAANS |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro PRSS3 protein mediated pancreatic cancer cell differentiation and metastasis regulation study with this protein as either coating matrix protein or as soluble factor.2. May be used for PPSS3 protein – protein interaction assay.3. May be used for specific antibody production. |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | PRSS3 protease, serine, 3 [ Homo sapiens ] |
| Official Symbol | PRSS3 |
| Synonyms | PRSS3; protease, serine, 3; protease, serine, 3 (mesotrypsin) , protease, serine, 4 (trypsin 4, brain) , PRSS4; trypsin-3; mesotrypsin; TRY3; TRY4; trypsin IV; trypsin III; trypsinogen 4; trypsinogen 5; trypsinogen IV; mesotrypsinogen; brain trypsinogen; pancreatic trypsinogen III; protease, serine, 4 (trypsin 4, brain); T9; MTG; PRSS4; |
| Gene ID | 5646 |
| mRNA Refseq | NM_001197097 |
| Protein Refseq | NP_001184026 |
| MIM | 613578 |
| UniProt ID | P35030 |
| Chromosome Location | 9p13 |
| Pathway | Alpha-defensins, organism-specific biosystem; Defensins, organism-specific biosystem; Immune System, organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; Innate Immune System, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; |
| Function | calcium ion binding; peptidase activity; protein binding; serine-type endopeptidase activity; serine-type peptidase activity; |
| ◆ Recombinant Proteins | ||
| PRSS3-4742R | Recombinant Rat PRSS3 Protein | +Inquiry |
| Prss3-663M | Active Recombinant Mouse Prss3 Protein, Met & His-tagged | +Inquiry |
| Prss3-662M | Active Recombinant Mouse Prss3 Protein, His-tagged | +Inquiry |
| PRSS3-3927H | Recombinant Human PRSS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRSS3-395C | Recombinant Chicken PRSS3 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRSS3-2046HCL | Recombinant Human PRSS3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRSS3 Products
Required fields are marked with *
My Review for All PRSS3 Products
Required fields are marked with *
