Recombinant Human PRSS8
| Cat.No. : | PRSS8-30708TH |
| Product Overview : | Recombinant fragment of Human PRSS8 with N-terminal proprietary tag. Predicted MW 36.52kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 99 amino acids |
| Description : | This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is highly expressed in prostate epithelia and is one of several proteolytic enzymes found in seminal fluid. The proprotein is cleaved to produce a light chain and a heavy chain which are associated by a disulfide bond. It is active on peptide linkages involving the carboxyl group of lysine or arginine. |
| Molecular Weight : | 36.520kDa inclusive of tags |
| Tissue specificity : | Found in prostate, liver, salivary gland, kidney, lung, pancreas, colon, bronchus and renal proximal tubular cells. In the prostate gland it may be synthesized in epithelial cells, secreted into the ducts, and excreted into the seminal fluid. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | AEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGS |
| Sequence Similarities : | Belongs to the peptidase S1 family.Contains 1 peptidase S1 domain. |
| Gene Name | PRSS8 protease, serine, 8 [ Homo sapiens ] |
| Official Symbol | PRSS8 |
| Synonyms | PRSS8; protease, serine, 8; prostasin; |
| Gene ID | 5652 |
| mRNA Refseq | NM_002773 |
| Protein Refseq | NP_002764 |
| MIM | 600823 |
| Uniprot ID | Q16651 |
| Chromosome Location | 16p11.2 |
| Function | peptidase activity; serine-type endopeptidase activity; serine-type peptidase activity; sodium channel regulator activity; |
| ◆ Recombinant Proteins | ||
| PRSS8-1994H | Recombinant Human PRSS8 protein, His-tagged | +Inquiry |
| PRSS8-30709TH | Recombinant Full Length Human PRSS8 Protein, GST tagged | +Inquiry |
| PRSS8-518H | Active Recombinant Human PRSS8 Protein, His-tagged | +Inquiry |
| PRSS8-4411R | Recombinant Rat PRSS8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRSS8-969R | Recombinant Rat PRSS8 Protein (Met1-Arg322), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRSS8-2865HCL | Recombinant Human PRSS8 cell lysate | +Inquiry |
| PRSS8-441MCL | Recombinant Mouse PRSS8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRSS8 Products
Required fields are marked with *
My Review for All PRSS8 Products
Required fields are marked with *
