Recombinant Human PRSS8

Cat.No. : PRSS8-30708TH
Product Overview : Recombinant fragment of Human PRSS8 with N-terminal proprietary tag. Predicted MW 36.52kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Description : This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is highly expressed in prostate epithelia and is one of several proteolytic enzymes found in seminal fluid. The proprotein is cleaved to produce a light chain and a heavy chain which are associated by a disulfide bond. It is active on peptide linkages involving the carboxyl group of lysine or arginine.
Molecular Weight : 36.520kDa inclusive of tags
Tissue specificity : Found in prostate, liver, salivary gland, kidney, lung, pancreas, colon, bronchus and renal proximal tubular cells. In the prostate gland it may be synthesized in epithelial cells, secreted into the ducts, and excreted into the seminal fluid.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGS
Sequence Similarities : Belongs to the peptidase S1 family.Contains 1 peptidase S1 domain.
Gene Name PRSS8 protease, serine, 8 [ Homo sapiens ]
Official Symbol PRSS8
Synonyms PRSS8; protease, serine, 8; prostasin;
Gene ID 5652
mRNA Refseq NM_002773
Protein Refseq NP_002764
MIM 600823
Uniprot ID Q16651
Chromosome Location 16p11.2
Function peptidase activity; serine-type endopeptidase activity; serine-type peptidase activity; sodium channel regulator activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRSS8 Products

Required fields are marked with *

My Review for All PRSS8 Products

Required fields are marked with *

0
cart-icon