Recombinant Human PRTFDC1 protein, GST-tagged
Cat.No. : | PRTFDC1-1995H |
Product Overview : | Recombinant Human PRTFDC1 protein(1-225 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | July 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 1-225 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIMVLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV |
Purity : | 90%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | PRTFDC1 phosphoribosyl transferase domain containing 1 [ Homo sapiens ] |
Official Symbol | PRTFDC1 |
Synonyms | PRTFDC1; phosphoribosyl transferase domain containing 1; phosphoribosyltransferase domain-containing protein 1; HHGP; FLJ11888; |
mRNA Refseq | NM_020200 |
Protein Refseq | NP_064585 |
MIM | 610751 |
UniProt ID | Q9NRG1 |
Gene ID | 56952 |
◆ Recombinant Proteins | ||
PRTFDC1-8636H | Recombinant Human PRTFDC1, His tagged | +Inquiry |
PRTFDC1-4402C | Recombinant Chicken PRTFDC1 | +Inquiry |
PRTFDC1-30710TH | Recombinant Human PRTFDC1, His-tagged | +Inquiry |
PRTFDC1-1995H | Recombinant Human PRTFDC1 protein, GST-tagged | +Inquiry |
PRTFDC1-9927Z | Recombinant Zebrafish PRTFDC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRTFDC1-2799HCL | Recombinant Human PRTFDC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRTFDC1 Products
Required fields are marked with *
My Review for All PRTFDC1 Products
Required fields are marked with *