Recombinant Human PRTN3 Protein, His tagged
Cat.No. : | PRTN3-001H |
Product Overview : | Recombinant Human PRTN3 Protein (26-249 aa) with C-His tag was expressed in Baculovirus-Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect cells |
Tag : | His |
Protein Length : | 26-249 aa |
Description : | Enables enzyme binding activity; serine-type endopeptidase activity; and signaling receptor binding activity. Involved in several processes, including mature conventional dendritic cell differentiation; neutrophil extravasation; and positive regulation of GTPase activity. Located in azurophil granule lumen; cytosol; and plasma membrane raft. |
Source : | Insect cells |
Species : | Human |
Tag : | C-His |
Molecular Weight : | 26 kDa |
AA Sequence : | MAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 5% Trehalose, 0.05% SKL |
Concentration : | 0.88 mg/mL by Bradford |
Gene Name | PRTN3 proteinase 3 [ Homo sapiens (human) ] |
Official Symbol | PRTN3 |
Synonyms | PRTN3; proteinase 3; myeloblastin; ACPA; AGP7; C ANCA; MBT; P29; PR 3; serine proteinase; neutrophil; Wegener granulomatosis autoantigen; NP-4; C-ANCA antigen; wegener autoantigen; leukocyte proteinase 3; neutrophil proteinase 4; azurophil granule protein 7; serine proteinase, neutrophil; MBN; NP4; PR3; PR-3; CANCA; C-ANCA |
Gene ID | 5657 |
mRNA Refseq | NM_002777 |
Protein Refseq | NP_002768 |
MIM | 177020 |
UniProt ID | P24158 |
◆ Recombinant Proteins | ||
PRTN3-6019H | Recombinant Human PRTN3 Protein (Ala26-Arg249), C-His tagged | +Inquiry |
PRTN3-406HF | Recombinant Full Length Human PRTN3 Protein | +Inquiry |
PRTN3-1779H | Recombinant Human PRTN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRTN3-301563H | Recombinant Human PRTN3 protein, GST-tagged | +Inquiry |
PRTN3-1556HFL | Recombinant Full Length Human PRTN3 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
PRTN3-01H | Native Human PRTN3 Protein | +Inquiry |
PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
PRTN3-243H | Native Human PRTN3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRTN3-2797HCL | Recombinant Human PRTN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRTN3 Products
Required fields are marked with *
My Review for All PRTN3 Products
Required fields are marked with *
0
Inquiry Basket