Recombinant Human PRTN3 Protein, His tagged
| Cat.No. : | PRTN3-001H |
| Product Overview : | Recombinant Human PRTN3 Protein (26-249 aa) with C-His tag was expressed in Baculovirus-Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect cells |
| Tag : | His |
| Protein Length : | 26-249 aa |
| Description : | Enables enzyme binding activity; serine-type endopeptidase activity; and signaling receptor binding activity. Involved in several processes, including mature conventional dendritic cell differentiation; neutrophil extravasation; and positive regulation of GTPase activity. Located in azurophil granule lumen; cytosol; and plasma membrane raft. |
| Source : | Insect cells |
| Species : | Human |
| Tag : | C-His |
| Molecular Weight : | 26 kDa |
| AA Sequence : | MAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 5% Trehalose, 0.05% SKL |
| Concentration : | 0.88 mg/mL by Bradford |
| Gene Name | PRTN3 proteinase 3 [ Homo sapiens (human) ] |
| Official Symbol | PRTN3 |
| Synonyms | PRTN3; proteinase 3; myeloblastin; ACPA; AGP7; C ANCA; MBT; P29; PR 3; serine proteinase; neutrophil; Wegener granulomatosis autoantigen; NP-4; C-ANCA antigen; wegener autoantigen; leukocyte proteinase 3; neutrophil proteinase 4; azurophil granule protein 7; serine proteinase, neutrophil; MBN; NP4; PR3; PR-3; CANCA; C-ANCA |
| Gene ID | 5657 |
| mRNA Refseq | NM_002777 |
| Protein Refseq | NP_002768 |
| MIM | 177020 |
| UniProt ID | P24158 |
| ◆ Recombinant Proteins | ||
| PRTN3-301563H | Recombinant Human PRTN3 protein, GST-tagged | +Inquiry |
| PRTN3-13534M | Recombinant Mouse PRTN3 Protein | +Inquiry |
| Prtn3-6959R | Recombinant Rat Prtn3 protein, His-tagged | +Inquiry |
| PRTN3-7193M | Recombinant Mouse PRTN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRTN3-3376H | Recombinant Human PRTN3 protein, His&Myc-tagged | +Inquiry |
| ◆ Native Proteins | ||
| PRTN3-243H | Native Human PRTN3 Protein | +Inquiry |
| PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
| PRTN3-01H | Native Human PRTN3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRTN3-2797HCL | Recombinant Human PRTN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRTN3 Products
Required fields are marked with *
My Review for All PRTN3 Products
Required fields are marked with *
