Recombinant Human PRTN3 Protein, His tagged

Cat.No. : PRTN3-001H
Product Overview : Recombinant Human PRTN3 Protein (26-249 aa) with C-His tag was expressed in Baculovirus-Insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect cells
Tag : His
Protein Length : 26-249 aa
Description : Enables enzyme binding activity; serine-type endopeptidase activity; and signaling receptor binding activity. Involved in several processes, including mature conventional dendritic cell differentiation; neutrophil extravasation; and positive regulation of GTPase activity. Located in azurophil granule lumen; cytosol; and plasma membrane raft.
Source : Insect cells
Species : Human
Tag : C-His
Molecular Weight : 26 kDa
AA Sequence : MAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 10% Glycerol, 5% Trehalose, 0.05% SKL
Concentration : 0.88 mg/mL by Bradford
Gene Name PRTN3 proteinase 3 [ Homo sapiens (human) ]
Official Symbol PRTN3
Synonyms PRTN3; proteinase 3; myeloblastin; ACPA; AGP7; C ANCA; MBT; P29; PR 3; serine proteinase; neutrophil; Wegener granulomatosis autoantigen; NP-4; C-ANCA antigen; wegener autoantigen; leukocyte proteinase 3; neutrophil proteinase 4; azurophil granule protein 7; serine proteinase, neutrophil; MBN; NP4; PR3; PR-3; CANCA; C-ANCA
Gene ID 5657
mRNA Refseq NM_002777
Protein Refseq NP_002768
MIM 177020
UniProt ID P24158

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRTN3 Products

Required fields are marked with *

My Review for All PRTN3 Products

Required fields are marked with *

0
cart-icon
0
compare icon