Recombinant Human PRTN3 Protein, His tagged

• Cat.No.: PRTN3-001H
• Product Overview: Recombinant Human PRTN3 Protein (26-249 aa) with C-His tag was expressed in Baculovirus-Insect cells.

Specification

• Species: Human
• Source: Insect cells
• Tag: His
• Protein Length: 26-249 aa
• Description: Enables enzyme binding activity; serine-type endopeptidase activity; and signaling receptor binding activity. Involved in several processes, including mature conventional dendritic cell differentiation; neutrophil extravasation; and positive regulation of GTPase activity. Located in azurophil granule lumen; cytosol; and plasma membrane raft.
• Source: Insect cells
• Species: Human
• Tag: C-His
• Molecular Weight: 26 kDa
• AA Sequence: MAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 10% Glycerol, 5% Trehalose, 0.05% SKL
• Concentration: 0.88 mg/mL by Bradford

Gene Information

• Gene Name: PRTN3 proteinase 3 [ Homo sapiens (human) ]
• Official Symbol: PRTN3
• Synonyms: PRTN3; proteinase 3; myeloblastin; ACPA; AGP7; C ANCA; MBT; P29; PR 3; serine proteinase; neutrophil; Wegener granulomatosis autoantigen; NP-4; C-ANCA antigen; wegener autoantigen; leukocyte proteinase 3; neutrophil proteinase 4; azurophil granule protein 7; serine proteinase, neutrophil; MBN; NP4; PR3; PR-3; CANCA; C-ANCA
• Gene ID: 5657
• mRNA Refseq: NM_002777
• Protein Refseq: NP_002768
• MIM: 177020
• UniProt ID: P24158