Recombinant Human PRXL2C Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PRXL2C-4408H
• Product Overview: C9orf21 MS Standard C13 and N15-labeled recombinant protein (NP_714542) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: PRXL2C (Peroxiredoxin Like 2C) is a Protein Coding gene.
• Molecular Mass: 24.7 kDa
• AA Sequence: MAAPAPVTRQVSGAAALVPAPSGPDSGQPLAAAVAELPVLDARGQRVPFGALFRERRAVVVFVRHFLCYICKEYVEDLAKIPRSFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGQSPHIKSNLLSGSLQSLWRAVTGPLFDFQGDPAQQGGTLILGPGNNIHFIHRDRNRLDHKPINSVLQLVGVQHVNFTNRPSVIHVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PRXL2C peroxiredoxin like 2C [ Homo sapiens (human) ]
• Official Symbol: PRXL2C
• Synonyms: PRXL2C; peroxiredoxin like 2C; AAED1; C9orf21; peroxiredoxin-like 2C; ApC/TSA antioxidant enzyme domain containing 1; UPF0308 protein C9orf21; ahpC/TSA antioxidant enzyme domain-containing protein 1; thioredoxin-like protein AAED1
• Gene ID: 195827
• mRNA Refseq: NM_153698
• Protein Refseq: NP_714542
• UniProt ID: Q7RTV5