Recombinant Human PRXL2C Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PRXL2C-4408H
Product Overview : C9orf21 MS Standard C13 and N15-labeled recombinant protein (NP_714542) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : PRXL2C (Peroxiredoxin Like 2C) is a Protein Coding gene.
Molecular Mass : 24.7 kDa
AA Sequence : MAAPAPVTRQVSGAAALVPAPSGPDSGQPLAAAVAELPVLDARGQRVPFGALFRERRAVVVFVRHFLCYICKEYVEDLAKIPRSFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGQSPHIKSNLLSGSLQSLWRAVTGPLFDFQGDPAQQGGTLILGPGNNIHFIHRDRNRLDHKPINSVLQLVGVQHVNFTNRPSVIHVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PRXL2C peroxiredoxin like 2C [ Homo sapiens (human) ]
Official Symbol PRXL2C
Synonyms PRXL2C; peroxiredoxin like 2C; AAED1; C9orf21; peroxiredoxin-like 2C; ApC/TSA antioxidant enzyme domain containing 1; UPF0308 protein C9orf21; ahpC/TSA antioxidant enzyme domain-containing protein 1; thioredoxin-like protein AAED1
Gene ID 195827
mRNA Refseq NM_153698
Protein Refseq NP_714542
UniProt ID Q7RTV5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRXL2C Products

Required fields are marked with *

My Review for All PRXL2C Products

Required fields are marked with *

0
cart-icon
0
compare icon