Recombinant Human PSAT1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PSAT1-4715H |
Product Overview : | PSAT1 MS Standard C13 and N15-labeled recombinant protein (NP_478059) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the class-V pyridoxal-phosphate-dependent aminotransferase family. The encoded protein is a phosphoserine aminotransferase and decreased expression may be associated with schizophrenia. Mutations in this gene are also associated with phosphoserine aminotransferase deficiency. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 1, 3, and 8. |
Molecular Mass : | 40.2 kDa |
AA Sequence : | MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQLSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PSAT1 phosphoserine aminotransferase 1 [ Homo sapiens (human) ] |
Official Symbol | PSAT1 |
Synonyms | PSAT1; phosphoserine aminotransferase 1; phosphoserine aminotransferase; PSA; endometrial progesterone-induced protein; phosphohydroxythreonine aminotransferase; EPIP; PSAT; MGC1460; |
Gene ID | 29968 |
mRNA Refseq | NM_058179 |
Protein Refseq | NP_478059 |
MIM | 610936 |
UniProt ID | Q9Y617 |
◆ Recombinant Proteins | ||
PSAT1-1113M | Recombinant Mouse PSAT1 Protein (1-370 aa), His-SUMO-tagged | +Inquiry |
PSAT1-1780H | Recombinant Human PSAT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSAT1-10199Z | Recombinant Zebrafish PSAT1 | +Inquiry |
PSAT1-1560H | Recombinant Human PSAT1, T7-tagged | +Inquiry |
Psat1-325M | Recombinant Mouse Psat1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSAT1-1424HCL | Recombinant Human PSAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSAT1 Products
Required fields are marked with *
My Review for All PSAT1 Products
Required fields are marked with *