Recombinant Human PSAT1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PSAT1-4715H
Product Overview : PSAT1 MS Standard C13 and N15-labeled recombinant protein (NP_478059) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the class-V pyridoxal-phosphate-dependent aminotransferase family. The encoded protein is a phosphoserine aminotransferase and decreased expression may be associated with schizophrenia. Mutations in this gene are also associated with phosphoserine aminotransferase deficiency. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 1, 3, and 8.
Molecular Mass : 40.2 kDa
AA Sequence : MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQLSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PSAT1 phosphoserine aminotransferase 1 [ Homo sapiens (human) ]
Official Symbol PSAT1
Synonyms PSAT1; phosphoserine aminotransferase 1; phosphoserine aminotransferase; PSA; endometrial progesterone-induced protein; phosphohydroxythreonine aminotransferase; EPIP; PSAT; MGC1460;
Gene ID 29968
mRNA Refseq NM_058179
Protein Refseq NP_478059
MIM 610936
UniProt ID Q9Y617

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSAT1 Products

Required fields are marked with *

My Review for All PSAT1 Products

Required fields are marked with *

0
cart-icon