Recombinant Human PSEN2 Protein(1-87 aa), GST-tagged
Cat.No. : | PSEN2-12H |
Product Overview : | Recombinant Human PSEN2 Protein(1-87 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-87 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGPEDGENTAQWRSQENEEDGEEDPDRYVCSGVPGRPPGLEEELTLKYGAKH |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
Gene Name | PSEN2 presenilin 2 (Alzheimer disease 4) [ Homo sapiens ] |
Official Symbol | PSEN2 |
Synonyms | PSEN2; presenilin 2 (Alzheimer disease 4); AD4; presenilin-2; AD3L; PS2; STM2 |
Gene ID | 5664 |
mRNA Refseq | NM_000447 |
Protein Refseq | NP_000438 |
MIM | 600759 |
UniProt ID | P49810 |
◆ Recombinant Proteins | ||
PSEN2-HCL | Recombinant Human PSEN2 Over expression Lysate, C-Myc/DDK-tagged | +Inquiry |
PSEN2-5875C | Recombinant Chicken PSEN2 | +Inquiry |
PSEN2-9063Z | Recombinant Zebrafish PSEN2 | +Inquiry |
PSEN2-28H | Recombinant Human presenilin 2 (Alzheimer disease 4) Protein, His-tagged | +Inquiry |
PSEN2-3644R | Recombinant Rhesus monkey PSEN2 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSEN2 Products
Required fields are marked with *
My Review for All PSEN2 Products
Required fields are marked with *
0
Inquiry Basket