Recombinant Human PSEN2

Cat.No. : PSEN2-28527TH
Product Overview : Recombinant fragment corresponding to amino acids 1-86 of Human Presenilin 2 with an N terminal proprietary tag; Predicted MWt 35.09 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 86 amino acids
Description : Alzheimers disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes. Two alternatively spliced transcript variants encoding different isoforms of PSEN2 have been identified.
Molecular Weight : 35.090kDa inclusive of tags
Tissue specificity : Isoform 1 is seen in the placenta, skeletal muscle and heart while isoform 2 is seen in the heart, brain, placenta, liver, skeletal muscle and kidney.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGPEDGENTAQWRSQENEEDGEEDPDRYVCSGVPGRPPGLEEELTLKYGAK
Sequence Similarities : Belongs to the peptidase A22A family.
Gene Name PSEN2 presenilin 2 (Alzheimer disease 4) [ Homo sapiens ]
Official Symbol PSEN2
Synonyms PSEN2; presenilin 2 (Alzheimer disease 4); AD4; presenilin-2; AD3L; PS2; STM2;
Gene ID 5664
mRNA Refseq NM_000447
Protein Refseq NP_000438
MIM 600759
Uniprot ID P49810
Chromosome Location 1q31-q42
Pathway A third proteolytic cleavage releases NICD, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem;
Function aspartic-type endopeptidase activity; endopeptidase activity; endopeptidase activity; peptidase activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSEN2 Products

Required fields are marked with *

My Review for All PSEN2 Products

Required fields are marked with *

0
cart-icon