Recombinant Human PSEN2
Cat.No. : | PSEN2-28527TH |
Product Overview : | Recombinant fragment corresponding to amino acids 1-86 of Human Presenilin 2 with an N terminal proprietary tag; Predicted MWt 35.09 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 86 amino acids |
Description : | Alzheimers disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes. Two alternatively spliced transcript variants encoding different isoforms of PSEN2 have been identified. |
Molecular Weight : | 35.090kDa inclusive of tags |
Tissue specificity : | Isoform 1 is seen in the placenta, skeletal muscle and heart while isoform 2 is seen in the heart, brain, placenta, liver, skeletal muscle and kidney. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGPEDGENTAQWRSQENEEDGEEDPDRYVCSGVPGRPPGLEEELTLKYGAK |
Sequence Similarities : | Belongs to the peptidase A22A family. |
Gene Name | PSEN2 presenilin 2 (Alzheimer disease 4) [ Homo sapiens ] |
Official Symbol | PSEN2 |
Synonyms | PSEN2; presenilin 2 (Alzheimer disease 4); AD4; presenilin-2; AD3L; PS2; STM2; |
Gene ID | 5664 |
mRNA Refseq | NM_000447 |
Protein Refseq | NP_000438 |
MIM | 600759 |
Uniprot ID | P49810 |
Chromosome Location | 1q31-q42 |
Pathway | A third proteolytic cleavage releases NICD, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; |
Function | aspartic-type endopeptidase activity; endopeptidase activity; endopeptidase activity; peptidase activity; protein binding; |
◆ Recombinant Proteins | ||
PSEN2-3462R | Recombinant Rhesus Macaque PSEN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSEN2-12H | Recombinant Human PSEN2 Protein(1-87 aa), GST-tagged | +Inquiry |
PSEN2-9063Z | Recombinant Zebrafish PSEN2 | +Inquiry |
PSEN2-28H | Recombinant Human presenilin 2 (Alzheimer disease 4) Protein, His-tagged | +Inquiry |
PSEN2-3644R | Recombinant Rhesus monkey PSEN2 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSEN2 Products
Required fields are marked with *
My Review for All PSEN2 Products
Required fields are marked with *