Recombinant Human PSENEN Full Length Transmembrane protein, His-tagged
| Cat.No. : | PSENEN-2467H |
| Product Overview : | Recombinant Human PSENEN protein(Q9NZ42)(1-101aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-101aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 14.8 kDa |
| AA Sequence : | MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PSENEN presenilin enhancer 2 homolog (C. elegans) [ Homo sapiens ] |
| Official Symbol | PSENEN |
| Synonyms | PSENEN; presenilin enhancer 2 homolog (C. elegans); gamma-secretase subunit PEN-2; PEN2; hematopoietic stem/progenitor cells protein MDS033; PEN-2; MDS033; MSTP064; |
| Gene ID | 55851 |
| mRNA Refseq | NM_172341 |
| Protein Refseq | NP_758844 |
| MIM | 607632 |
| UniProt ID | Q9NZ42 |
| ◆ Recombinant Proteins | ||
| PSENEN-13547M | Recombinant Mouse PSENEN Protein | +Inquiry |
| RFL6288BF | Recombinant Full Length Bovine Gamma-Secretase Subunit Pen-2(Psenen) Protein, His-Tagged | +Inquiry |
| RFL22065MF | Recombinant Full Length Mouse Gamma-Secretase Subunit Pen-2(Psenen) Protein, His-Tagged | +Inquiry |
| PSENEN-7202M | Recombinant Mouse PSENEN Protein, His (Fc)-Avi-tagged | +Inquiry |
| PSENEN-4760R | Recombinant Rat PSENEN Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSENEN-2789HCL | Recombinant Human PSENEN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSENEN Products
Required fields are marked with *
My Review for All PSENEN Products
Required fields are marked with *



