Recombinant Human PSMA2, His-tagged
Cat.No. : | PSMA2-31102TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 3-234 of Human Proteasome 20S alpha 2 with N terminal His tag; 232 amino acids, 28kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 3-234 a.a. |
Description : | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 57 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAAN GVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMG PDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQE YTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAW KATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLK ESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA |
Sequence Similarities : | Belongs to the peptidase T1A family. |
Gene Name | PSMA2 proteasome (prosome, macropain) subunit, alpha type, 2 [ Homo sapiens ] |
Official Symbol | PSMA2 |
Synonyms | PSMA2; proteasome (prosome, macropain) subunit, alpha type, 2; proteasome subunit alpha type-2; HC3; MU; PMSA2; |
Gene ID | 5683 |
mRNA Refseq | NM_002787 |
Protein Refseq | NP_002778 |
MIM | 176842 |
Uniprot ID | P25787 |
Chromosome Location | 7p13 |
Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; |
Function | peptidase activity; protein binding; threonine-type endopeptidase activity; |
◆ Recombinant Proteins | ||
PSMA2-31102TH | Recombinant Human PSMA2, His-tagged | +Inquiry |
PSMA2-3039Z | Recombinant Zebrafish PSMA2 | +Inquiry |
PSMA2-2010H | Recombinant Human PSMA2, GST-tagged | +Inquiry |
PSMA2-2079C | Recombinant Chicken PSMA2 | +Inquiry |
PSMA2-3466R | Recombinant Rhesus Macaque PSMA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMA2-2779HCL | Recombinant Human PSMA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMA2 Products
Required fields are marked with *
My Review for All PSMA2 Products
Required fields are marked with *
0
Inquiry Basket