Recombinant Human PSMA2, His-tagged

Cat.No. : PSMA2-31102TH
Product Overview : Recombinant fragment, corresponding to amino acids 3-234 of Human Proteasome 20S alpha 2 with N terminal His tag; 232 amino acids, 28kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 3-234 a.a.
Description : The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 57 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAAN GVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMG PDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQE YTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAW KATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLK ESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA
Sequence Similarities : Belongs to the peptidase T1A family.
Gene Name PSMA2 proteasome (prosome, macropain) subunit, alpha type, 2 [ Homo sapiens ]
Official Symbol PSMA2
Synonyms PSMA2; proteasome (prosome, macropain) subunit, alpha type, 2; proteasome subunit alpha type-2; HC3; MU; PMSA2;
Gene ID 5683
mRNA Refseq NM_002787
Protein Refseq NP_002778
MIM 176842
Uniprot ID P25787
Chromosome Location 7p13
Pathway APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;
Function peptidase activity; protein binding; threonine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSMA2 Products

Required fields are marked with *

My Review for All PSMA2 Products

Required fields are marked with *

0
cart-icon