Recombinant Human PSMA2 Protein isoform 1, C-His-tagged

Cat.No. : PSMA2-01H
Product Overview : Recombinant Human PSMA2 Protein isoform 1, fused to His-tag at C-terminus, was expressed in HEK293T.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 153-347 aa
Description : The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit.
Form : Liquid. In PBS PH7.4 and 5% glycerinum.
Molecular Mass : ~ 21.6 kDa
AA Sequence : YENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFR GNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYR RGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVHHHHHH
Purity : >90% as determined by SDS-PAGE
Storage : Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
Concentration : 0.5 mg/ml
Gene Name PSMA2 proteasome 20S subunit alpha 2 [ Homo sapiens (human) ]
Official Symbol PSMA2
Synonyms MU; HC3; PSC2; PMSA2; PSMA2
Gene ID 5683
mRNA Refseq NM_002787.5
Protein Refseq NP_002778.1
MIM 176842
UniProt ID P25787

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSMA2 Products

Required fields are marked with *

My Review for All PSMA2 Products

Required fields are marked with *

0
cart-icon
0
compare icon