Recombinant Human PSMA2 Protein isoform 1, C-His-tagged
Cat.No. : | PSMA2-01H |
Product Overview : | Recombinant Human PSMA2 Protein isoform 1, fused to His-tag at C-terminus, was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 153-347 aa |
Description : | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. |
Form : | Liquid. In PBS PH7.4 and 5% glycerinum. |
Molecular Mass : | ~ 21.6 kDa |
AA Sequence : | YENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFR GNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYR RGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVHHHHHH |
Purity : | >90% as determined by SDS-PAGE |
Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.5 mg/ml |
Gene Name | PSMA2 proteasome 20S subunit alpha 2 [ Homo sapiens (human) ] |
Official Symbol | PSMA2 |
Synonyms | MU; HC3; PSC2; PMSA2; PSMA2 |
Gene ID | 5683 |
mRNA Refseq | NM_002787.5 |
Protein Refseq | NP_002778.1 |
MIM | 176842 |
UniProt ID | P25787 |
◆ Recombinant Proteins | ||
PSMA2-2010H | Recombinant Human PSMA2, GST-tagged | +Inquiry |
PSMA2-3039Z | Recombinant Zebrafish PSMA2 | +Inquiry |
PSMA2-2079C | Recombinant Chicken PSMA2 | +Inquiry |
PSMA2-30429TH | Recombinant Full Length Human PSMA2 Protein, His-tagged | +Inquiry |
PSMA2-6877H | Recombinant Human Proteasome (prosome, macropain) Subunit, Alpha Type, 2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMA2-2779HCL | Recombinant Human PSMA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSMA2 Products
Required fields are marked with *
My Review for All PSMA2 Products
Required fields are marked with *
0
Inquiry Basket