Recombinant Human PSMA2 Protein isoform 1, C-His-tagged

• Cat.No.: PSMA2-01H
• Product Overview: Recombinant Human PSMA2 Protein isoform 1, fused to His-tag at C-terminus, was expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 153-347 aa
• Description: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit.
• Form: Liquid. In PBS PH7.4 and 5% glycerinum.
• Molecular Mass: ~ 21.6 kDa
• AA Sequence: YENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFR GNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYR RGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVHHHHHH
• Purity: >90% as determined by SDS-PAGE
• Storage: Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.5 mg/ml

Gene Information

• Gene Name: PSMA2 proteasome 20S subunit alpha 2 [ Homo sapiens (human) ]
• Official Symbol: PSMA2
• Synonyms: MU; HC3; PSC2; PMSA2; PSMA2
• Gene ID: 5683
• mRNA Refseq: NM_002787.5
• Protein Refseq: NP_002778.1
• MIM: 176842
• UniProt ID: P25787