Recombinant Human PSMB10, His-tagged
Cat.No. : | PSMB10-31221TH |
Product Overview : | Recombinant full length protein, (amino acids 40-237, excluding propeptide) of Human PSMB10 with N terminal His tag; 255 amino acids, 26.9 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 198 amino acids |
Description : | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Proteolytic processing is required to generate a mature subunit. Expression of this gene is induced by gamma interferon, and this gene product replaces catalytic subunit 2 (proteasome beta 7 subunit) in the immunoproteasome. |
Conjugation : | HIS |
Molecular Weight : | 26.900kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.02% Tris HCl, 40% Glycerol, 0.58% Sodium chloride |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE |
Sequence Similarities : | Belongs to the peptidase T1B family. |
Gene Name | PSMB10 proteasome (prosome, macropain) subunit, beta type, 10 [ Homo sapiens ] |
Official Symbol | PSMB10 |
Synonyms | PSMB10; proteasome (prosome, macropain) subunit, beta type, 10; MECL1; proteasome subunit beta type-10; beta2i; LMP10; MGC1665; |
Gene ID | 5699 |
mRNA Refseq | NM_002801 |
Protein Refseq | NP_002792 |
MIM | 176847 |
Uniprot ID | P40306 |
Chromosome Location | 16q22.1 |
Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; |
Function | peptidase activity; threonine-type endopeptidase activity; |
◆ Recombinant Proteins | ||
PSMB10-3654R | Recombinant Rhesus monkey PSMB10 Protein, His-tagged | +Inquiry |
PSMB10-2016H | Recombinant Human PSMB10, GST-tagged | +Inquiry |
PSMB10-4429R | Recombinant Rat PSMB10 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSMB10-13570M | Recombinant Mouse PSMB10 Protein | +Inquiry |
PSMB10-3472R | Recombinant Rhesus Macaque PSMB10 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMB10-512HCL | Recombinant Human PSMB10 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSMB10 Products
Required fields are marked with *
My Review for All PSMB10 Products
Required fields are marked with *
0
Inquiry Basket