Recombinant Human PSMB10, His-tagged

Cat.No. : PSMB10-31221TH
Product Overview : Recombinant full length protein, (amino acids 40-237, excluding propeptide) of Human PSMB10 with N terminal His tag; 255 amino acids, 26.9 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 198 amino acids
Description : The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Proteolytic processing is required to generate a mature subunit. Expression of this gene is induced by gamma interferon, and this gene product replaces catalytic subunit 2 (proteasome beta 7 subunit) in the immunoproteasome.
Conjugation : HIS
Molecular Weight : 26.900kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.02% Tris HCl, 40% Glycerol, 0.58% Sodium chloride
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE
Sequence Similarities : Belongs to the peptidase T1B family.
Gene Name PSMB10 proteasome (prosome, macropain) subunit, beta type, 10 [ Homo sapiens ]
Official Symbol PSMB10
Synonyms PSMB10; proteasome (prosome, macropain) subunit, beta type, 10; MECL1; proteasome subunit beta type-10; beta2i; LMP10; MGC1665;
Gene ID 5699
mRNA Refseq NM_002801
Protein Refseq NP_002792
MIM 176847
Uniprot ID P40306
Chromosome Location 16q22.1
Pathway APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;
Function peptidase activity; threonine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSMB10 Products

Required fields are marked with *

My Review for All PSMB10 Products

Required fields are marked with *

0
cart-icon
0
compare icon