Recombinant Human PSMB2, His-tagged
| Cat.No. : | PSMB2-30366TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-201 of Human Proteasome subunit beta type 2 with N terminal His tag, 21kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-201 a.a. |
| Description : | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 115 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSE KILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPT AAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALY YMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNI SFPKQGS |
| Sequence Similarities : | Belongs to the peptidase T1B family. |
| Full Length : | Full L. |
| Gene Name | PSMB2 proteasome (prosome, macropain) subunit, beta type, 2 [ Homo sapiens ] |
| Official Symbol | PSMB2 |
| Synonyms | PSMB2; proteasome (prosome, macropain) subunit, beta type, 2; proteasome subunit beta type-2; HC7 I; |
| Gene ID | 5690 |
| mRNA Refseq | NM_001199779 |
| Protein Refseq | NP_001186708 |
| MIM | 602175 |
| Uniprot ID | P49721 |
| Chromosome Location | 1p34.2 |
| Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; |
| Function | peptidase activity; threonine-type endopeptidase activity; |
| ◆ Recombinant Proteins | ||
| PSMB2-1321H | Recombinant Human Proteasome (prosome, macropain) Subunit, Beta Type, 2, His-tagged | +Inquiry |
| PSMB2-31209TH | Recombinant Human PSMB2, His-tagged | +Inquiry |
| PSMB2-4771R | Recombinant Rat PSMB2 Protein | +Inquiry |
| PSMB2-3656R | Recombinant Rhesus monkey PSMB2 Protein, His-tagged | +Inquiry |
| PSMB2-5165H | Recombinant Human PSMB2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSMB2-2774HCL | Recombinant Human PSMB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMB2 Products
Required fields are marked with *
My Review for All PSMB2 Products
Required fields are marked with *



