Recombinant Human PSMB4, His-tagged
Cat.No. : | PSMB4-30367TH |
Product Overview : | Recombinant full length Human Proteasome subunit beta type 4 (amino acids 46-264) with an N terminal His tag; 240aa, 26.6kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 219 amino acids |
Description : | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. |
Conjugation : | HIS |
Molecular Weight : | 26.600kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 30% Glycerol, 0.02% DTT, 0.58% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMTQNPMVTGTSVLGVKFEGG VVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYAD FQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSR RSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLAT GYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYR DARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE |
Sequence Similarities : | Belongs to the peptidase T1B family. |
Gene Name | PSMB4 proteasome (prosome, macropain) subunit, beta type, 4 [ Homo sapiens ] |
Official Symbol | PSMB4 |
Synonyms | PSMB4; proteasome (prosome, macropain) subunit, beta type, 4; proteasome subunit beta type-4; HN3; PROS26; |
Gene ID | 5692 |
mRNA Refseq | NM_002796 |
Protein Refseq | NP_002787 |
MIM | 602177 |
Uniprot ID | P28070 |
Chromosome Location | 1q21 |
Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; |
Function | lipopolysaccharide binding; peptidase activity; threonine-type endopeptidase activity; |
◆ Recombinant Proteins | ||
PSMB4-3658R | Recombinant Rhesus monkey PSMB4 Protein, His-tagged | +Inquiry |
Psmb4-5180M | Recombinant Mouse Psmb4 Protein, Myc/DDK-tagged | +Inquiry |
PSMB4-2536Z | Recombinant Zebrafish PSMB4 | +Inquiry |
PSMB4-2018H | Recombinant Human PSMB4, GST-tagged | +Inquiry |
PSMB4-5164H | Recombinant Human PSMB4 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMB4-2772HCL | Recombinant Human PSMB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSMB4 Products
Required fields are marked with *
My Review for All PSMB4 Products
Required fields are marked with *
0
Inquiry Basket