Recombinant Human PSMC3IP protein, T7/His-tagged
Cat.No. : | PSMC3IP-153H |
Product Overview : | Recombinant human HOP2 cDNA (216 aa, Isoform-II) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 216 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVV VKTLEQLAQQGKIKEKMYGKQKIYFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAELKELSSALT TPEMQKEIQELKKECAGYRERLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQ FFEEVGIETDEDYNVTLPDP |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | PSMC3IP PSMC3 interacting protein [ Homo sapiens ] |
Official Symbol | PSMC3IP |
Synonyms | PSMC3IP; PSMC3 interacting protein; homologous-pairing protein 2 homolog; GT198; HUMGT198A; TBP 1 interacting protein; TBPIP; DBD-interacting; TBP-1-interacting protein; nuclear receptor coactivator GT198; tat-binding protein 1-interacting protein; proteasome 26S ATPase subunit 3-interacting protein; HOP2; ODG3; |
Gene ID | 29893 |
mRNA Refseq | NM_001256014 |
Protein Refseq | NP_001242943 |
MIM | 608665 |
UniProt ID | Q9P2W1 |
Chromosome Location | 17q21.2 |
Pathway | Androgen Receptor Signaling Pathway, organism-specific biosystem; Meiosis, organism-specific biosystem; Meiotic Recombination, organism-specific biosystem; |
Function | DBD domain binding; DNA binding; androgen receptor binding; estrogen receptor binding; glucocorticoid receptor binding; ligand-dependent nuclear receptor transcription coactivator activity; protein homodimerization activity; thyroid hormone receptor bindi |
◆ Recombinant Proteins | ||
PSMC3IP-153H | Recombinant Human PSMC3IP protein, T7/His-tagged | +Inquiry |
PSMC3IP-4440R | Recombinant Rat PSMC3IP Protein, His (Fc)-Avi-tagged | +Inquiry |
PSMC3IP-4450H | Recombinant Human PSMC3IP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Psmc3ip-5185M | Recombinant Mouse Psmc3ip Protein, Myc/DDK-tagged | +Inquiry |
PSMC3IP-4781R | Recombinant Rat PSMC3IP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMC3IP-2762HCL | Recombinant Human PSMC3IP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMC3IP Products
Required fields are marked with *
My Review for All PSMC3IP Products
Required fields are marked with *