Recombinant Human PSMD7, His-tagged

Cat.No. : PSMD7-31228TH
Product Overview : Recombinant fragment, corresponding to amino acids 53-324 of Human PSMD7 with an N terminal His tag. Predicted MWt: 32 kDa,
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 53-324 a.a.
Description : The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 17.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 146 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIV GWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKD LGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAE EVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDI RSYLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFV KAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRD AEKKEGQEKEESKKDRKEDKEKDKDKEKSDVKKEEKKE KK
Sequence Similarities : Belongs to the peptidase M67A family.Contains 1 MPN (JAB/Mov34) domain.
Gene Name PSMD7 proteasome (prosome, macropain) 26S subunit, non-ATPase, 7 [ Homo sapiens ]
Official Symbol PSMD7
Synonyms PSMD7; proteasome (prosome, macropain) 26S subunit, non-ATPase, 7; proteasome (prosome, macropain) 26S subunit, non ATPase, 7 (Mov34 homolog); 26S proteasome non-ATPase regulatory subunit 7; MOV34; Mov34 homolog; P40; Rpn8; S12;
Gene ID 5713
mRNA Refseq NM_002811
Protein Refseq NP_002802
MIM 157970
Uniprot ID P51665
Chromosome Location 16q22.3
Pathway APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSMD7 Products

Required fields are marked with *

My Review for All PSMD7 Products

Required fields are marked with *

0
cart-icon
0
compare icon