Recombinant Human PSMD7, His-tagged
Cat.No. : | PSMD7-31228TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 53-324 of Human PSMD7 with an N terminal His tag. Predicted MWt: 32 kDa, |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 53-324 a.a. |
Description : | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 17. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 146 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIV GWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKD LGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAE EVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDI RSYLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFV KAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRD AEKKEGQEKEESKKDRKEDKEKDKDKEKSDVKKEEKKE KK |
Sequence Similarities : | Belongs to the peptidase M67A family.Contains 1 MPN (JAB/Mov34) domain. |
Gene Name | PSMD7 proteasome (prosome, macropain) 26S subunit, non-ATPase, 7 [ Homo sapiens ] |
Official Symbol | PSMD7 |
Synonyms | PSMD7; proteasome (prosome, macropain) 26S subunit, non-ATPase, 7; proteasome (prosome, macropain) 26S subunit, non ATPase, 7 (Mov34 homolog); 26S proteasome non-ATPase regulatory subunit 7; MOV34; Mov34 homolog; P40; Rpn8; S12; |
Gene ID | 5713 |
mRNA Refseq | NM_002811 |
Protein Refseq | NP_002802 |
MIM | 157970 |
Uniprot ID | P51665 |
Chromosome Location | 16q22.3 |
Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; |
◆ Recombinant Proteins | ||
PSMD7-0303H | Recombinant Human PSMD7 Protein (P2-K324), Tag Free | +Inquiry |
PSMD7-0304H | Recombinant Human PSMD7 Protein (P2-K324), His tagged | +Inquiry |
PSMD7-3492R | Recombinant Rhesus Macaque PSMD7 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSMD7-3674R | Recombinant Rhesus monkey PSMD7 Protein, His-tagged | +Inquiry |
PSMD7-424H | Recombinant Human PSMD7 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMD7-2745HCL | Recombinant Human PSMD7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMD7 Products
Required fields are marked with *
My Review for All PSMD7 Products
Required fields are marked with *