Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human PSMD8

Cat.No. : PSMD8-30431TH
Product Overview : Recombinant fragment of Human PSMD8 with N terminal proprietary tag; Predicted MW 54.27 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway.An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 1.
Protein length : 257 amino acids
Molecular Weight : 54.270kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTG TKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKC YYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELE RLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPA ESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFF NTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPST ELAKQVIEYARQLEMIV
Sequence Similarities : Belongs to the proteasome subunit S14 family.
Gene Name : PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 [ Homo sapiens ]
Official Symbol : PSMD8
Synonyms : PSMD8; proteasome (prosome, macropain) 26S subunit, non-ATPase, 8; 26S proteasome non-ATPase regulatory subunit 8; HIP6; HYPF; Nin1p; p31; Rpn12; S14;
Gene ID : 5714
mRNA Refseq : NM_002812
Protein Refseq : NP_002803
Uniprot ID : P48556
Chromosome Location : 19q13.2
Pathway : APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends