Recombinant Human PSMD8
| Cat.No. : | PSMD8-30431TH |
| Product Overview : | Recombinant fragment of Human PSMD8 with N terminal proprietary tag; Predicted MW 54.27 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 257 amino acids |
| Description : | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway.An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 1. |
| Molecular Weight : | 54.270kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTG TKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKC YYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELE RLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPA ESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFF NTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPST ELAKQVIEYARQLEMIV |
| Sequence Similarities : | Belongs to the proteasome subunit S14 family. |
| Gene Name | PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 [ Homo sapiens ] |
| Official Symbol | PSMD8 |
| Synonyms | PSMD8; proteasome (prosome, macropain) 26S subunit, non-ATPase, 8; 26S proteasome non-ATPase regulatory subunit 8; HIP6; HYPF; Nin1p; p31; Rpn12; S14; |
| Gene ID | 5714 |
| mRNA Refseq | NM_002812 |
| Protein Refseq | NP_002803 |
| Uniprot ID | P48556 |
| Chromosome Location | 19q13.2 |
| Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; |
| ◆ Recombinant Proteins | ||
| PSMD8-30431TH | Recombinant Human PSMD8 | +Inquiry |
| PSMD8-2636H | Recombinant Human PSMD8 Protein, His-tagged | +Inquiry |
| PSMD8-358Z | Recombinant Zebrafish PSMD8 | +Inquiry |
| Psmd8-5199M | Recombinant Mouse Psmd8 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSMD8-2744HCL | Recombinant Human PSMD8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMD8 Products
Required fields are marked with *
My Review for All PSMD8 Products
Required fields are marked with *
