Recombinant Human PSMD9 protein, His-tagged
Cat.No. : | PSMD9-3673H |
Product Overview : | Recombinant Human PSMD9 protein(1-102 aa), fused to His tag, was expressed in E. coli. |
Availability | June 28, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-102 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTARHNIICLQNDHKAVMKQVEEALHQLHA |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PSMD9 proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 [ Homo sapiens ] |
Official Symbol | PSMD9 |
Synonyms | PSMD9; proteasome (prosome, macropain) 26S subunit, non-ATPase, 9; 26S proteasome non-ATPase regulatory subunit 9; p27; Rpn4; homolog of rat Bridge 1; 26S proteasome regulatory subunit p27; proteasome 26S non-ATPase regulatory subunit 9; MGC8644; |
Gene ID | 5715 |
mRNA Refseq | NM_002813 |
Protein Refseq | NP_002804 |
MIM | 603146 |
UniProt ID | O00233 |
◆ Recombinant Proteins | ||
PSMD9-26023TH | Recombinant Human PSMD9, His-tagged | +Inquiry |
PSMD9-569Z | Recombinant Zebrafish PSMD9 | +Inquiry |
PSMD9-4788R | Recombinant Rat PSMD9 Protein | +Inquiry |
PSMD9-3673H | Recombinant Human PSMD9 protein, His-tagged | +Inquiry |
PSMD9-1338C | Recombinant Chicken PSMD9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMD9-2743HCL | Recombinant Human PSMD9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMD9 Products
Required fields are marked with *
My Review for All PSMD9 Products
Required fields are marked with *