Recombinant Human PSME3 protein, His&Myc-tagged
Cat.No. : | PSME3-5333H |
Product Overview : | Recombinant Human PSME3 protein(P61289)(2-254aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-254aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.8 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY |
Gene Name | PSME3 proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) [ Homo sapiens ] |
Official Symbol | PSME3 |
Synonyms | PSME3; proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki); proteasome activator complex subunit 3; Ki; PA28 gamma; PA28G; REG GAMMA; PA28gamma; Ki antigen; Ki nuclear autoantigen; proteasome activator 28-gamma; 11S regulator complex gamma subunit; 11S regulator complex subunit gamma; proteasome activator 28 subunit gamma; activator of multicatalytic protease subunit 3; REG-GAMMA; PA28-gamma; |
Gene ID | 10197 |
mRNA Refseq | NM_005789 |
Protein Refseq | NP_005780 |
MIM | 605129 |
UniProt ID | P61289 |
◆ Recombinant Proteins | ||
PSME3-13603M | Recombinant Mouse PSME3 Protein | +Inquiry |
PSME3-827C | Recombinant Cynomolgus PSME3 Protein, His-tagged | +Inquiry |
PSME3-644H | Recombinant Human PSME3 protein, His-GST-tagged | +Inquiry |
PSME3-30434TH | Recombinant Human PSME3, His-tagged | +Inquiry |
PSME3-8953Z | Recombinant Zebrafish PSME3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSME3-2739HCL | Recombinant Human PSME3 293 Cell Lysate | +Inquiry |
PSME3-2740HCL | Recombinant Human PSME3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSME3 Products
Required fields are marked with *
My Review for All PSME3 Products
Required fields are marked with *