Recombinant Human PSMF1, His-tagged

Cat.No. : PSMF1-31210TH
Product Overview : Recombinant full length Human Proteasome Inhibitor subunit 1 PI3 1 with N terminal His tag; 291 amino acids with tag, Predicted MWt 31.9 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 271 amino acids
Description : The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a protein that inhibits the activation of the proteasome by the 11S and 19S regulators. Alternative transcript variants have been identified for this gene.
Conjugation : HIS
Molecular Weight : 31.900kDa inclusive of tags
Form : Liquid
Purity : by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT, 0.002% PMSF
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMAGLEVLFASAAPAITCRQD ALVCFLHWEVVTHGYCGLGVGDQPGPNDKKSELLPAGWNN NKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQ VADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIIT PIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSR QPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRA LIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDH LPPPGYDDMYL
Sequence Similarities : Belongs to the proteasome inhibitor PI31 family.
Gene Name PSMF1 proteasome (prosome, macropain) inhibitor subunit 1 (PI31) [ Homo sapiens ]
Official Symbol PSMF1
Synonyms PSMF1; proteasome (prosome, macropain) inhibitor subunit 1 (PI31); proteasome inhibitor PI31 subunit; PI31; proteasome inhibitor hP131 subunit;
Gene ID 9491
mRNA Refseq NM_006814
Protein Refseq NP_006805
Uniprot ID Q92530
Chromosome Location 20p13
Pathway APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;
Function endopeptidase inhibitor activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSMF1 Products

Required fields are marked with *

My Review for All PSMF1 Products

Required fields are marked with *

0
cart-icon