Recombinant Human PSMF1, His-tagged
Cat.No. : | PSMF1-31210TH |
Product Overview : | Recombinant full length Human Proteasome Inhibitor subunit 1 PI3 1 with N terminal His tag; 291 amino acids with tag, Predicted MWt 31.9 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 271 amino acids |
Description : | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a protein that inhibits the activation of the proteasome by the 11S and 19S regulators. Alternative transcript variants have been identified for this gene. |
Conjugation : | HIS |
Molecular Weight : | 31.900kDa inclusive of tags |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT, 0.002% PMSF |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAGLEVLFASAAPAITCRQD ALVCFLHWEVVTHGYCGLGVGDQPGPNDKKSELLPAGWNN NKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQ VADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIIT PIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSR QPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRA LIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDH LPPPGYDDMYL |
Sequence Similarities : | Belongs to the proteasome inhibitor PI31 family. |
Gene Name | PSMF1 proteasome (prosome, macropain) inhibitor subunit 1 (PI31) [ Homo sapiens ] |
Official Symbol | PSMF1 |
Synonyms | PSMF1; proteasome (prosome, macropain) inhibitor subunit 1 (PI31); proteasome inhibitor PI31 subunit; PI31; proteasome inhibitor hP131 subunit; |
Gene ID | 9491 |
mRNA Refseq | NM_006814 |
Protein Refseq | NP_006805 |
Uniprot ID | Q92530 |
Chromosome Location | 20p13 |
Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; |
Function | endopeptidase inhibitor activity; protein binding; |
◆ Recombinant Proteins | ||
PSMF1-4733H | Recombinant Human PSMF1 protein, His-SUMO-tagged | +Inquiry |
PSMF1-4746H | Recombinant Human PSMF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PSMF1-3223C | Recombinant Chicken PSMF1 | +Inquiry |
PSMF1-2036H | Recombinant Human PSMF1, GST-tagged | +Inquiry |
PSMF1-1788H | Recombinant Human PSMF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMF1-2737HCL | Recombinant Human PSMF1 293 Cell Lysate | +Inquiry |
PSMF1-2738HCL | Recombinant Human PSMF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMF1 Products
Required fields are marked with *
My Review for All PSMF1 Products
Required fields are marked with *