Recombinant Human PSMF1, His-tagged

• Cat.No.: PSMF1-31210TH
• Product Overview: Recombinant full length Human Proteasome Inhibitor subunit 1 PI3 1 with N terminal His tag; 291 amino acids with tag, Predicted MWt 31.9 kDa.

Specification

• Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a protein that inhibits the activation of the proteasome by the 11S and 19S regulators. Alternative transcript variants have been identified for this gene.
• Protein length: 271 amino acids
• Conjugation: HIS
• Molecular Weight: 31.900kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT, 0.002% PMSF
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAGLEVLFASAAPAITCRQD ALVCFLHWEVVTHGYCGLGVGDQPGPNDKKSELLPAGWNN NKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQ VADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIIT PIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSR QPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRA LIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDH LPPPGYDDMYL
• Sequence Similarities: Belongs to the proteasome inhibitor PI31 family.

Gene Information

• Gene Name: PSMF1 proteasome (prosome, macropain) inhibitor subunit 1 (PI31) [ Homo sapiens ]
• Official Symbol: PSMF1
• Synonyms: PSMF1; proteasome (prosome, macropain) inhibitor subunit 1 (PI31); proteasome inhibitor PI31 subunit; PI31; proteasome inhibitor hP131 subunit
• Gene ID: 9491
• mRNA Refseq: NM_006814
• Protein Refseq: NP_006805
• Uniprot ID: Q92530
• Chromosome Location: 20p13
• Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem
• Function: endopeptidase inhibitor activity; protein binding