Recombinant Human PSMG3, His-tagged
Cat.No. : | PSMG3-30897TH |
Product Overview : | Recombinant full length Human PSMG3 with N terminal His tag; 142 amino acids with tag; MWt 15.2 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 122 amino acids |
Description : | PSMG3 is a chaperone protein which promotes assembly of the 20S proteasome. This protein may cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes. |
Conjugation : | HIS |
Molecular Weight : | 15.200kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW |
Sequence Similarities : | Belongs to the PSMG3 family. |
Gene Name | PSMG3 proteasome (prosome, macropain) assembly chaperone 3 [ Homo sapiens ] |
Official Symbol | PSMG3 |
Synonyms | PSMG3; proteasome (prosome, macropain) assembly chaperone 3; C7orf48, chromosome 7 open reading frame 48; proteasome assembly chaperone 3; MGC10911; PAC3; |
Gene ID | 84262 |
mRNA Refseq | NM_001134340 |
Protein Refseq | NP_001127812 |
Uniprot ID | Q9BT73 |
Chromosome Location | 7p22.3 |
◆ Recombinant Proteins | ||
PSMG3-4516H | Recombinant Human PSMG3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PSMG3-3496R | Recombinant Rhesus Macaque PSMG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSMG3-653Z | Recombinant Zebrafish PSMG3 | +Inquiry |
PSMG3-301552H | Recombinant Human PSMG3 protein, GST-tagged | +Inquiry |
PSMG3-3678R | Recombinant Rhesus monkey PSMG3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMG3-2734HCL | Recombinant Human PSMG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMG3 Products
Required fields are marked with *
My Review for All PSMG3 Products
Required fields are marked with *