Recombinant Human PSMG3, His-tagged

• Cat.No.: PSMG3-30897TH
• Product Overview: Recombinant full length Human PSMG3 with N terminal His tag; 142 amino acids with tag; MWt 15.2 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 122 amino acids
• Description: PSMG3 is a chaperone protein which promotes assembly of the 20S proteasome. This protein may cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes.
• Conjugation: HIS
• Molecular Weight: 15.200kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW
• Sequence Similarities: Belongs to the PSMG3 family.

Gene Information

• Gene Name: PSMG3 proteasome (prosome, macropain) assembly chaperone 3 [ Homo sapiens ]
• Official Symbol: PSMG3
• Synonyms: PSMG3; proteasome (prosome, macropain) assembly chaperone 3; C7orf48, chromosome 7 open reading frame 48; proteasome assembly chaperone 3; MGC10911; PAC3
• Gene ID: 84262
• mRNA Refseq: NM_001134340
• Protein Refseq: NP_001127812
• Uniprot ID: Q9BT73
• Chromosome Location: 7p22.3