Recombinant Human PSMG3, His-tagged

Cat.No. : PSMG3-30897TH
Product Overview : Recombinant full length Human PSMG3 with N terminal His tag; 142 amino acids with tag; MWt 15.2 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 122 amino acids
Description : PSMG3 is a chaperone protein which promotes assembly of the 20S proteasome. This protein may cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes.
Conjugation : HIS
Molecular Weight : 15.200kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW
Sequence Similarities : Belongs to the PSMG3 family.
Gene Name PSMG3 proteasome (prosome, macropain) assembly chaperone 3 [ Homo sapiens ]
Official Symbol PSMG3
Synonyms PSMG3; proteasome (prosome, macropain) assembly chaperone 3; C7orf48, chromosome 7 open reading frame 48; proteasome assembly chaperone 3; MGC10911; PAC3;
Gene ID 84262
mRNA Refseq NM_001134340
Protein Refseq NP_001127812
Uniprot ID Q9BT73
Chromosome Location 7p22.3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSMG3 Products

Required fields are marked with *

My Review for All PSMG3 Products

Required fields are marked with *

0
cart-icon
0
compare icon