Recombinant Human PSMG3 protein, GST-tagged
Cat.No. : | PSMG3-301552H |
Product Overview : | Recombinant Human PSMG3 (1-122 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Trp122 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | PSMG3 proteasome (prosome, macropain) assembly chaperone 3 [ Homo sapiens ] |
Official Symbol | PSMG3 |
Synonyms | PSMG3; proteasome (prosome, macropain) assembly chaperone 3; C7orf48, chromosome 7 open reading frame 48; proteasome assembly chaperone 3; MGC10911; PAC3; PAC-3; hPAC3; proteasome assembling chaperone 3; C7orf48; |
Gene ID | 84262 |
mRNA Refseq | NM_001134340 |
Protein Refseq | NP_001127812 |
UniProt ID | Q9BT73 |
◆ Recombinant Proteins | ||
PSMG3-301552H | Recombinant Human PSMG3 protein, GST-tagged | +Inquiry |
PSMG3-3678R | Recombinant Rhesus monkey PSMG3 Protein, His-tagged | +Inquiry |
PSMG3-7232M | Recombinant Mouse PSMG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Psmg3-5206M | Recombinant Mouse Psmg3 Protein, Myc/DDK-tagged | +Inquiry |
PSMG3-4927C | Recombinant Chicken PSMG3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMG3-2734HCL | Recombinant Human PSMG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSMG3 Products
Required fields are marked with *
My Review for All PSMG3 Products
Required fields are marked with *
0
Inquiry Basket