Recombinant Human PSMG3 Protein, GST-tagged
| Cat.No. : | PSMG3-4360H |
| Product Overview : | Human MGC10911 full-length ORF ( AAH04308, 1 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | PSMG3 (Proteasome Assembly Chaperone 3) is a Protein Coding gene. |
| Molecular Mass : | 39.16 kDa |
| AA Sequence : | MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | PSMG3 proteasome (prosome, macropain) assembly chaperone 3 [ Homo sapiens ] |
| Official Symbol | PSMG3 |
| Synonyms | PSMG3; proteasome (prosome, macropain) assembly chaperone 3; C7orf48, chromosome 7 open reading frame 48; proteasome assembly chaperone 3; MGC10911; PAC3; PAC-3; hPAC3; proteasome assembling chaperone 3; C7orf48; |
| Gene ID | 84262 |
| mRNA Refseq | NM_001134340 |
| Protein Refseq | NP_001127812 |
| UniProt ID | Q9BT73 |
| ◆ Recombinant Proteins | ||
| PSMG3-3678R | Recombinant Rhesus monkey PSMG3 Protein, His-tagged | +Inquiry |
| PSMG3-301552H | Recombinant Human PSMG3 protein, GST-tagged | +Inquiry |
| Psmg3-5206M | Recombinant Mouse Psmg3 Protein, Myc/DDK-tagged | +Inquiry |
| PSMG3-4360H | Recombinant Human PSMG3 Protein, GST-tagged | +Inquiry |
| PSMG3-7232M | Recombinant Mouse PSMG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSMG3-2734HCL | Recombinant Human PSMG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMG3 Products
Required fields are marked with *
My Review for All PSMG3 Products
Required fields are marked with *
