Recombinant Human PTBP1

Cat.No. : PTBP1-30323TH
Product Overview : Recombinant fragment of Human PTBP1 with a proprietary N-terminal tag; Molecular weight 36.63 kDa inclusuve of tag
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has four repeats of quasi-RNA recognition motif (RRM) domains that bind RNAs. This protein binds to the intronic polypyrimidine tracts that requires pre-mRNA splicing and acts via the protein degradation ubiquitin-proteasome pathway. It may also promote the binding of U2 snRNP to pre-mRNAs. This protein is localized in the nucleoplasm and it is also detected in the perinucleolar structure. Alternatively spliced transcript variants encoding different isoforms have been described.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KKFKGDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGK VTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQ PIYIQFSNHKELKTDSSPNQ
Sequence Similarities : Contains 4 RRM (RNA recognition motif) domains.
Gene Name PTBP1 polypyrimidine tract binding protein 1 [ Homo sapiens ]
Official Symbol PTBP1
Synonyms PTBP1; polypyrimidine tract binding protein 1; polypyrimidine tract binding protein (heterogeneous nuclear ribonucleoprotein I) , PTB; polypyrimidine tract-binding protein 1; heterogeneous nuclear ribonucleoprotein I; HNRNP I; HNRPI; pPTB; PTB 1; PTB2; PT
Gene ID 5725
mRNA Refseq NM_002819
Protein Refseq NP_002810
MIM 600693
Uniprot ID P26599
Chromosome Location 19p13.3
Pathway Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; mRNA Processing, organism-specific biosystem; mRNA Splicing, organism-specific biosystem;
Function RNA binding; RNA binding; nucleotide binding; poly-pyrimidine tract binding; pre-mRNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTBP1 Products

Required fields are marked with *

My Review for All PTBP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon