Recombinant Human PTCD2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PTCD2-5189H |
Product Overview : | PTCD2 MS Standard C13 and N15-labeled recombinant protein (NP_079030) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | PTCD2 (Pentatricopeptide Repeat Domain 2) is a Protein Coding gene. Diseases associated with PTCD2 include Leigh Syndrome and Mitochondrial Metabolism Disease. |
Molecular Mass : | 43.8 kDa |
AA Sequence : | MVRDSMAAAFRPSNRVLLQALQILVYPGVGGSGSVSCRCPLGAKRYLLTDNVVKLKEFQQKKVAVACNLSGTKETYFRNLKKKLTQNKLILKGELITLLHLCESRDHVELAKNVIYRYHAENKNFTLGEYKFGPLFVRLCYELDLEESAVELMKDQHLRGFFSDSTSFNILMDMLFIKGKYKSALQVLIEMKNQDVKFTKDTYVLAFAICYKLNSPESFKICTTLREEALLKGEILSRRASCFAVALALNQNEMAKAVSIFSQIMNPESIACINLNIIIHIQSNMLENLIKTLKNAAEGNLSKFVKRHVFSEEVLAKVREKVKDVPALVAKFDEIYGTLHITGQVTTDSLDAVLCHTPRDRKSHTLLLNKRMVSRRTFQPLSQSLLAETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PTCD2 pentatricopeptide repeat domain 2 [ Homo sapiens (human) ] |
Official Symbol | PTCD2 |
Synonyms | PTCD2; pentatricopeptide repeat domain 2; pentatricopeptide repeat-containing protein 2; FLJ12598; |
Gene ID | 79810 |
mRNA Refseq | NM_024754 |
Protein Refseq | NP_079030 |
MIM | 615484 |
UniProt ID | Q8WV60 |
◆ Recombinant Proteins | ||
PTCD2-2383Z | Recombinant Zebrafish PTCD2 | +Inquiry |
Ptcd2-5213M | Recombinant Mouse Ptcd2 Protein, Myc/DDK-tagged | +Inquiry |
PTCD2-5189H | Recombinant Human PTCD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PTCD2-13622M | Recombinant Mouse PTCD2 Protein | +Inquiry |
PTCD2-3695H | Recombinant Human PTCD2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTCD2-2725HCL | Recombinant Human PTCD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTCD2 Products
Required fields are marked with *
My Review for All PTCD2 Products
Required fields are marked with *
0
Inquiry Basket