Recombinant Human PTCD2 protein, His-tagged
Cat.No. : | PTCD2-3695H |
Product Overview : | Recombinant Human PTCD2 protein(1-236 aa), fused to His tag, was expressed in E. coli. |
Availability | July 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-236 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MKDQHLRGFFSDSTSFNILMDMLFIKGKYKSALQVLIEMKNQDVKFTKDTYVLAFAICYKLNSPESFKICTTLREEALLKGEILSRRASCFAVALALNQNEMAKAVSIFSQIMNPESIACINLNIIIHIQSNMLENLIKTLKNAAEGNLSKFVKRHVFSEEVLAKVREKVKDVPALVAKFDEIYGTLHITGQVTTDSLDAVLCHTPRDRKSHTLLLNKRMVSRRTFQPLSQSLLAE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PTCD2 pentatricopeptide repeat domain 2 [ Homo sapiens ] |
Official Symbol | PTCD2 |
Synonyms | PTCD2; pentatricopeptide repeat domain 2; pentatricopeptide repeat-containing protein 2; FLJ12598; |
Gene ID | 79810 |
mRNA Refseq | NM_024754 |
Protein Refseq | NP_079030 |
UniProt ID | Q8WV60 |
◆ Recombinant Proteins | ||
Ptcd2-5213M | Recombinant Mouse Ptcd2 Protein, Myc/DDK-tagged | +Inquiry |
PTCD2-5189H | Recombinant Human PTCD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PTCD2-13622M | Recombinant Mouse PTCD2 Protein | +Inquiry |
PTCD2-3695H | Recombinant Human PTCD2 protein, His-tagged | +Inquiry |
PTCD2-2383Z | Recombinant Zebrafish PTCD2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTCD2-2725HCL | Recombinant Human PTCD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTCD2 Products
Required fields are marked with *
My Review for All PTCD2 Products
Required fields are marked with *