Recombinant Human PTCD3 protein, His-tagged
Cat.No. : | PTCD3-4011H |
Product Overview : | Recombinant Human PTCD3 protein(368-689 aa), fused to His tag, was expressed in E. coli. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 368-689 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SLATYHHIIRLFDQPGDPLKRSSFIIYDIMNELMGKRFSPKDPDDDKFFQSAMSICSSLRDLELAYQVHGLLKTGDNWKFIGPDQHRNFYYSKFFDLICLMEQIDVTLKWYEDLIPSAYFPHSQTMIHLLQALDVANRLEVIPKIWKDSKEYGHTFRSDLREEILMLMARDKHPPELQVAFADCAADIKSAYESQPIRQTAQDWPATSLNCIAILFLRAGRTQEAWKMLGLFRKHNKIPRSELLNELMDSAKVSNSPSQAIEVVELASAFSLPICEGLTQRVMSDFAINQEQKEALSNLTALTSDSDTDSSSDSDSDTSEGK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PTCD3 pentatricopeptide repeat domain 3 [ Homo sapiens ] |
Official Symbol | PTCD3 |
Synonyms | PTCD3; pentatricopeptide repeat domain 3; pentatricopeptide repeat-containing protein 3, mitochondrial; DKFZp666K071; FLJ20758; TRG-15; transformation-related gene 15 protein; |
Gene ID | 55037 |
mRNA Refseq | NM_017952 |
Protein Refseq | NP_060422 |
UniProt ID | Q96EY7 |
◆ Recombinant Proteins | ||
PTCD3-7242M | Recombinant Mouse PTCD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTCD3-3040H | Recombinant Human PTCD3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Ptcd3-5214M | Recombinant Mouse Ptcd3 Protein, Myc/DDK-tagged | +Inquiry |
PTCD3-3501Z | Recombinant Zebrafish PTCD3 | +Inquiry |
PTCD3-4011H | Recombinant Human PTCD3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTCD3-2724HCL | Recombinant Human PTCD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTCD3 Products
Required fields are marked with *
My Review for All PTCD3 Products
Required fields are marked with *