Recombinant Human PTCD3 protein, His-tagged
| Cat.No. : | PTCD3-4011H |
| Product Overview : | Recombinant Human PTCD3 protein(368-689 aa), fused to His tag, was expressed in E. coli. |
| Availability | May 28, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 368-689 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SLATYHHIIRLFDQPGDPLKRSSFIIYDIMNELMGKRFSPKDPDDDKFFQSAMSICSSLRDLELAYQVHGLLKTGDNWKFIGPDQHRNFYYSKFFDLICLMEQIDVTLKWYEDLIPSAYFPHSQTMIHLLQALDVANRLEVIPKIWKDSKEYGHTFRSDLREEILMLMARDKHPPELQVAFADCAADIKSAYESQPIRQTAQDWPATSLNCIAILFLRAGRTQEAWKMLGLFRKHNKIPRSELLNELMDSAKVSNSPSQAIEVVELASAFSLPICEGLTQRVMSDFAINQEQKEALSNLTALTSDSDTDSSSDSDSDTSEGK |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PTCD3 pentatricopeptide repeat domain 3 [ Homo sapiens ] |
| Official Symbol | PTCD3 |
| Synonyms | PTCD3; pentatricopeptide repeat domain 3; pentatricopeptide repeat-containing protein 3, mitochondrial; DKFZp666K071; FLJ20758; TRG-15; transformation-related gene 15 protein; |
| Gene ID | 55037 |
| mRNA Refseq | NM_017952 |
| Protein Refseq | NP_060422 |
| UniProt ID | Q96EY7 |
| ◆ Recombinant Proteins | ||
| PTCD3-13623M | Recombinant Mouse PTCD3 Protein | +Inquiry |
| PTCD3-3501Z | Recombinant Zebrafish PTCD3 | +Inquiry |
| PTCD3-7242M | Recombinant Mouse PTCD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PTCD3-4011H | Recombinant Human PTCD3 protein, His-tagged | +Inquiry |
| Ptcd3-5214M | Recombinant Mouse Ptcd3 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PTCD3-2724HCL | Recombinant Human PTCD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTCD3 Products
Required fields are marked with *
My Review for All PTCD3 Products
Required fields are marked with *
