Recombinant Human PTCH1
Cat.No. : | PTCH1-29531TH |
Product Overview : | Recombinant fragment corresonding to amino acids 841-940 of Human Patched / PTCH with an N terminal proprietary tag; Predicted MWt 36.63kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a member of the patched gene family. The encoded protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis, as well as the desert hedgehog and indian hedgehog proteins. This gene functions as a tumor suppressor. Mutations of this gene have been associated with basal cell nevus syndrome, esophageal squamous cell carcinoma, trichoepitheliomas, transitional cell carcinomas of the bladder, as well as holoprosencephaly. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional splice variants have been described, but their full length sequences and biological validity cannot be determined currently. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | In the adult, expressed in brain, lung, liver, heart, placenta, skeletal muscle, pancreas and kidney. Expressed in tumor cells but not in normal skin. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQAN |
Sequence Similarities : | Belongs to the patched family.Contains 1 SSD (sterol-sensing) domain. |
Gene Name | PTCH1 patched 1 [ Homo sapiens ] |
Official Symbol | PTCH1 |
Synonyms | PTCH1; patched 1; NBCCS, patched (Drosophila) homolog , patched homolog (Drosophila) , patched homolog 1 (Drosophila) , PTCH; protein patched homolog 1; BCNS; |
Gene ID | 5727 |
mRNA Refseq | NM_000264 |
Protein Refseq | NP_000255 |
MIM | 601309 |
Uniprot ID | Q13635 |
Chromosome Location | 9q22.1-q31 |
Pathway | Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; |
Function | hedgehog receptor activity; heparin binding; patched binding; protein binding; receptor activity; |
◆ Recombinant Proteins | ||
PTCH1-7243M | Recombinant Mouse PTCH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTCH1-1772H | Recombinant Human PTCH1 protein, His-tagged | +Inquiry |
PTCH1-6519C | Recombinant Chicken PTCH1 | +Inquiry |
PTCH1-13624M | Recombinant Mouse PTCH1 Protein | +Inquiry |
PTCH1-414H | Recombinant Human PTCH1 Protein, DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTCH1-2723HCL | Recombinant Human PTCH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTCH1 Products
Required fields are marked with *
My Review for All PTCH1 Products
Required fields are marked with *
0
Inquiry Basket