Recombinant Human PTCH1

Cat.No. : PTCH1-29531TH
Product Overview : Recombinant fragment corresonding to amino acids 841-940 of Human Patched / PTCH with an N terminal proprietary tag; Predicted MWt 36.63kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a member of the patched gene family. The encoded protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis, as well as the desert hedgehog and indian hedgehog proteins. This gene functions as a tumor suppressor. Mutations of this gene have been associated with basal cell nevus syndrome, esophageal squamous cell carcinoma, trichoepitheliomas, transitional cell carcinomas of the bladder, as well as holoprosencephaly. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional splice variants have been described, but their full length sequences and biological validity cannot be determined currently.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : In the adult, expressed in brain, lung, liver, heart, placenta, skeletal muscle, pancreas and kidney. Expressed in tumor cells but not in normal skin.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQAN
Sequence Similarities : Belongs to the patched family.Contains 1 SSD (sterol-sensing) domain.
Gene Name PTCH1 patched 1 [ Homo sapiens ]
Official Symbol PTCH1
Synonyms PTCH1; patched 1; NBCCS, patched (Drosophila) homolog , patched homolog (Drosophila) , patched homolog 1 (Drosophila) , PTCH; protein patched homolog 1; BCNS;
Gene ID 5727
mRNA Refseq NM_000264
Protein Refseq NP_000255
MIM 601309
Uniprot ID Q13635
Chromosome Location 9q22.1-q31
Pathway Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem;
Function hedgehog receptor activity; heparin binding; patched binding; protein binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTCH1 Products

Required fields are marked with *

My Review for All PTCH1 Products

Required fields are marked with *

0
cart-icon
0
compare icon