Recombinant Human PTGDR
Cat.No. : | PTGDR-31204TH |
Product Overview : | Recombinant full length Human Prostaglandin D2 Receptor with N terminal proprietary tag. Predicted MW 65.60 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a G-protein-coupled receptor. It has been shown to function as a prostanoid DP receptor. The activity of this receptor is mainly mediated by G-S proteins that stimulate adenylate cyclase resulting in an elevation of intracellular cAMP and Ca2+.Knockout studies in mice suggest that the ligand of this receptor,prostaglandin D2 (PGD2), functions as a mast cell-derived mediator to trigger asthmatic responses. |
Protein length : | 359 amino acids |
Molecular Weight : | 65.600kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed in retinal choroid, ciliary epithelium, longitudinal and circular ciliary muscles, iris, small intestine and platelet membranes. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGL LARSGLGWCSRRPLRPLPSVFYMLVCGLTVTDLLGKCLLS PVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFS LAFCALPFMGFGKFVQYCPGTWCFIQMVHEEGSLSVLGYS VLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLP VIYRAYYGAFKDVKEKNRTSEEAEDLRALRFLSVISIVDP WIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL |
Sequence Similarities : | Belongs to the G-protein coupled receptor 1 family. |
Gene Name : | PTGDR prostaglandin D2 receptor (DP) [ Homo sapiens ] |
Official Symbol : | PTGDR |
Synonyms : | PTGDR; prostaglandin D2 receptor (DP); prostaglandin D2 receptor; DP; DP1; PTGDR1; |
Gene ID : | 5729 |
mRNA Refseq : | NM_000953 |
Protein Refseq : | NP_000944 |
MIM : | 604687 |
Uniprot ID : | Q13258 |
Chromosome Location : | 14q22.1 |
Pathway : | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Eicosanoid ligand-binding receptors, organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; |
Function : | G-protein coupled receptor activity; prostaglandin D receptor activity; prostaglandin J receptor activity; protein binding; receptor activity; |
Products Types
◆ Recombinant Protein | ||
PTGDR-4461R | Recombinant Rat PTGDR Protein, His (Fc)-Avi-tagged | +Inquiry |
PTGDR-7251M | Recombinant Mouse PTGDR Protein, His (Fc)-Avi-tagged | +Inquiry |
PTGDR-4802R | Recombinant Rat PTGDR Protein | +Inquiry |
PTGDR-13634M | Recombinant Mouse PTGDR Protein | +Inquiry |
◆ Lysates | ||
PTGDR-2719HCL | Recombinant Human PTGDR 293 Cell Lysate | +Inquiry |
◆ Assay kits | ||
Kit-1485 | cAMP PTGDR CHO-K1 GPCR Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket