Recombinant Human PTGDR
Cat.No. : | PTGDR-31204TH |
Product Overview : | Recombinant full length Human Prostaglandin D2 Receptor with N terminal proprietary tag. Predicted MW 65.60 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 359 amino acids |
Description : | The protein encoded by this gene is a G-protein-coupled receptor. It has been shown to function as a prostanoid DP receptor. The activity of this receptor is mainly mediated by G-S proteins that stimulate adenylate cyclase resulting in an elevation of intracellular cAMP and Ca2+.Knockout studies in mice suggest that the ligand of this receptor,prostaglandin D2 (PGD2), functions as a mast cell-derived mediator to trigger asthmatic responses. |
Molecular Weight : | 65.600kDa inclusive of tags |
Tissue specificity : | Expressed in retinal choroid, ciliary epithelium, longitudinal and circular ciliary muscles, iris, small intestine and platelet membranes. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGL LARSGLGWCSRRPLRPLPSVFYMLVCGLTVTDLLGKCLLS PVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFS LAFCALPFMGFGKFVQYCPGTWCFIQMVHEEGSLSVLGYS VLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLP VIYRAYYGAFKDVKEKNRTSEEAEDLRALRFLSVISIVDP WIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL |
Sequence Similarities : | Belongs to the G-protein coupled receptor 1 family. |
Gene Name | PTGDR prostaglandin D2 receptor (DP) [ Homo sapiens ] |
Official Symbol | PTGDR |
Synonyms | PTGDR; prostaglandin D2 receptor (DP); prostaglandin D2 receptor; DP; DP1; PTGDR1; |
Gene ID | 5729 |
mRNA Refseq | NM_000953 |
Protein Refseq | NP_000944 |
MIM | 604687 |
Uniprot ID | Q13258 |
Chromosome Location | 14q22.1 |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Eicosanoid ligand-binding receptors, organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; |
Function | G-protein coupled receptor activity; prostaglandin D receptor activity; prostaglandin J receptor activity; protein binding; receptor activity; |
◆ Cell & Tissue Lysates | ||
PTGDR-2719HCL | Recombinant Human PTGDR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTGDR Products
Required fields are marked with *
My Review for All PTGDR Products
Required fields are marked with *
0
Inquiry Basket