Recombinant Human PTGER4 protein, His-tagged

Cat.No. : PTGER4-3628H
Product Overview : Recombinant Human PTGER4 protein(333-488 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability September 09, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 333-488 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AASequence : RKTVLSKAIEKIKCLFCRIGGSRRERSGQHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPGMGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSETLNLSEKCI
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name PTGER4 prostaglandin E receptor 4 (subtype EP4) [ Homo sapiens ]
Official Symbol PTGER4
Synonyms PTGER4; prostaglandin E receptor 4 (subtype EP4); prostaglandin E2 receptor EP4 subtype; EP4; prostanoid EP4 receptor; PGE receptor EP4 subtype; PGE receptor, EP4 subtype; PGE2 receptor EP4 subtype; EP4R; MGC126583;
Gene ID 5734
mRNA Refseq NM_000958
Protein Refseq NP_000949
MIM 601586
UniProt ID P35408

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTGER4 Products

Required fields are marked with *

My Review for All PTGER4 Products

Required fields are marked with *

0
cart-icon
0
compare icon