Recombinant Human PTGER4 protein, His-tagged
| Cat.No. : | PTGER4-3628H |
| Product Overview : | Recombinant Human PTGER4 protein(333-488 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | November 05, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 333-488 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | RKTVLSKAIEKIKCLFCRIGGSRRERSGQHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPGMGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSETLNLSEKCI |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | PTGER4 prostaglandin E receptor 4 (subtype EP4) [ Homo sapiens ] |
| Official Symbol | PTGER4 |
| Synonyms | PTGER4; prostaglandin E receptor 4 (subtype EP4); prostaglandin E2 receptor EP4 subtype; EP4; prostanoid EP4 receptor; PGE receptor EP4 subtype; PGE receptor, EP4 subtype; PGE2 receptor EP4 subtype; EP4R; MGC126583; |
| Gene ID | 5734 |
| mRNA Refseq | NM_000958 |
| Protein Refseq | NP_000949 |
| MIM | 601586 |
| UniProt ID | P35408 |
| ◆ Recombinant Proteins | ||
| RFL7296HF | Recombinant Full Length Human Prostaglandin E2 Receptor Ep4 Subtype(Ptger4) Protein, His-Tagged | +Inquiry |
| RFL26880OF | Recombinant Full Length Rabbit Prostaglandin E2 Receptor Ep4 Subtype(Ptger4) Protein, His-Tagged | +Inquiry |
| Ptger4-529M | Recombinant Mouse Ptger4 protein | +Inquiry |
| PTGER4-4468R | Recombinant Rat PTGER4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PTGER4-3628H | Recombinant Human PTGER4 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PTGER4-2716HCL | Recombinant Human PTGER4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTGER4 Products
Required fields are marked with *
My Review for All PTGER4 Products
Required fields are marked with *
