Recombinant Human PTGES Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PTGES-1544H |
Product Overview : | PTGES MS Standard C13 and N15-labeled recombinant protein (NP_004869) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. |
Molecular Mass : | 17.1 kDa |
AA Sequence : | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PTGES prostaglandin E synthase [ Homo sapiens (human) ] |
Official Symbol | PTGES |
Synonyms | PTGES; prostaglandin E synthase; MGST1L1; glutathione S transferase 1 like 1; MGST IV; MGST1 L1; MGST1 like 1; microsomal glutathione S transferase 1 like 1; microsomal prostaglandin E synthase 1; p53 induced gene 12; PIG12; TP53I12; tumor protein p53 inducible protein 12; MGST1-like 1; p53-induced gene 12 protein; p53-induced apoptosis protein 12; glutathione S-transferase 1-like 1; microsomal prostaglandin E synthase-1; microsomal glutathione S-transferase 1-like 1; PGES; MPGES; PP102; PP1294; MGST-IV; mPGES-1; MGST1-L1; MGC10317; |
Gene ID | 9536 |
mRNA Refseq | NM_004878 |
Protein Refseq | NP_004869 |
MIM | 605172 |
UniProt ID | O14684 |
◆ Cell & Tissue Lysates | ||
PTGES-2715HCL | Recombinant Human PTGES 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTGES Products
Required fields are marked with *
My Review for All PTGES Products
Required fields are marked with *