Recombinant Human PTGS2 protein, FLAG/His-tagged
| Cat.No. : | PTGS2-32H |
| Product Overview : | Recombinant Human PTGS2(1-604 aa) fused with FLAG/His tag at C-terminal was expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | Flag&His |
| Protein Length : | 1-604 a.a. |
| Description : | Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of ex |
| Form : | 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04% Tween-20, 20% glycerol, 80 µg/ml FLAG peptide, 300 µM diethyldithiocarbamate and 0.08% Triton X-100. |
| Molecular Mass : | 71 kDa |
| AA Sequence : | MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVH YILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPL GVKGKKQLPDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETL ARQRKLRLFKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRV CDVLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQNRIAAEFNTLYH WHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRVAGGRNVPPAVQKVSQASIDQSRQMKYQ SFNEYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLM GNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTELDYKDDDDKHHHHHH |
| Purity : | ≥90% |
| Applications : | Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling. |
| Storage : | At least 6 months at -80 centigrade. Avoid freeze/thaw cycles. Storing diluted enzyme is not recommended, if necessary, use carrier protein (BSA 0.1 – 0.5%). |
| Concentration : | 0.33 mg/ml |
| Gene Name | PTGS2 prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase) [ Homo sapiens ] |
| Official Symbol | PTGS2 |
| Synonyms | PTGS2; prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase); prostaglandin G/H synthase 2; COX2; PHS II; PGH synthase 2; cyclooxygenase 2b; prostaglandin H2 synthase 2; COX-2; PHS-2; PGG/HS; PGHS-2; hCox-2; GRIPGHS; |
| Gene ID | 5743 |
| mRNA Refseq | NM_000963 |
| Protein Refseq | NP_000954 |
| MIM | 600262 |
| UniProt ID | P35354 |
| Chromosome Location | 1q25.2-q25.3 |
| Pathway | Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Biological oxidations, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; COX reactions, organism-specific biosystem |
| Function | enzyme binding; heme binding; heme binding; lipid binding; metal ion binding; oxidoreductase activity; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen; peroxidase activity; peroxidase activity; peroxidase activity; prostaglandin-endoperoxide synthase activity; |
| ◆ Recombinant Proteins | ||
| PTGS2-857HF | Recombinant Human PTGS2 Protein, His-tagged, FITC conjugated | +Inquiry |
| PTGS2-857HAF555 | Recombinant Human PTGS2 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| PTGS2-13651M | Recombinant Mouse PTGS2 Protein | +Inquiry |
| PTGS2-13HFL | Recombinant Full Length Human PTGS2 Protein, C-His-tagged | +Inquiry |
| PTGS2-26360TH | Recombinant Human PTGS2, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| PTGS2-57S | Native Sheep PTGS2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PTGS2-643HCL | Recombinant Human PTGS2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTGS2 Products
Required fields are marked with *
My Review for All PTGS2 Products
Required fields are marked with *
