Recombinant Human PTGS2 protein, FLAG/His-tagged

Cat.No. : PTGS2-32H
Product Overview : Recombinant Human PTGS2(1-604 aa) fused with FLAG/His tag at C-terminal was expressed in Insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : Flag&His
Protein Length : 1-604 a.a.
Description : Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes the inducible isozyme. It is regulated by specific stimulatory events, suggesting that it is responsible for the prostanoid biosynthesis involved in inflammation and mitogenesis.
Form : 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04% Tween-20, 20% glycerol, 80 µg/ml FLAG peptide, 300 µM diethyldithiocarbamate and 0.08% Triton X-100.
Molecular Mass : 71 kDa
AA Sequence : MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVH YILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPL GVKGKKQLPDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETL ARQRKLRLFKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRV CDVLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQNRIAAEFNTLYH WHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRVAGGRNVPPAVQKVSQASIDQSRQMKYQ SFNEYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLM GNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTELDYKDDDDKHHHHHH
Purity : ≥90%
Applications : Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.
Storage : At least 6 months at -80 centigrade. Avoid freeze/thaw cycles. Storing diluted enzyme is not recommended, if necessary, use carrier protein (BSA 0.1 – 0.5%).
Concentration : 0.33 mg/ml
Gene Name PTGS2 prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase) [ Homo sapiens ]
Official Symbol PTGS2
Synonyms PTGS2; prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase); prostaglandin G/H synthase 2; COX2; PHS II; PGH synthase 2; cyclooxygenase 2b; prostaglandin H2 synthase 2; COX-2; PHS-2; PGG/HS; PGHS-2; hCox-2; GRIPGHS;
Gene ID 5743
mRNA Refseq NM_000963
Protein Refseq NP_000954
MIM 600262
UniProt ID P35354
Chromosome Location 1q25.2-q25.3
Pathway Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Biological oxidations, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; COX reactions, organism-specific biosystem
Function enzyme binding; heme binding; heme binding; lipid binding; metal ion binding; oxidoreductase activity; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen; peroxidase activity; peroxidase activity; peroxidase activity; prostaglandin-endoperoxide synthase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTGS2 Products

Required fields are marked with *

My Review for All PTGS2 Products

Required fields are marked with *

0
cart-icon
0
compare icon