Recombinant Human PTH protein
Cat.No. : | PTH-01H |
Product Overview : | Recombinant Human PTH protein (7-84 a.a.) was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 78 |
Description : | This gene encodes a member of the parathyroid family of proteins. The encoded preproprotein is proteolytically processed to generate a protein that binds to the parathyroid hormone/parathyroid hormone-related peptide receptor and regulates blood calcium and phosphate levels. Excess production of the encoded protein, known as hyperparathyroidism, can result in hypercalcemia and kidney stones. On the other hand, defective processing of the encoded protein may lead to hypoparathyroidism, which can result in hypocalcemia and numbness. Alternative splicing results in multiple transcript variants. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Molecular Mass : | Approximately 8.8 kDa, a single non-glycosylated polypeptide chain containing 78 amino acids. |
AA Sequence : | LMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ |
Endotoxin : | Less than 1 EU/μg of rHuPTH7-84 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | PTH |
Official Symbol | PTH |
Synonyms | PTH; parathyroid hormone; parathormone; parathyrin; parathyroid hormone 1; PTH1; |
Gene ID | 5741 |
mRNA Refseq | NM_000315 |
Protein Refseq | NP_000306 |
MIM | 168450 |
UniProt ID | P01270 |
◆ Recombinant Proteins | ||
PTH-04H | Recombinant Human PTH protein | +Inquiry |
PTH-4477R | Recombinant Rat PTH Protein, His (Fc)-Avi-tagged | +Inquiry |
PTH-3941H | Recombinant Human PTH Protein, His (Fc)-Avi-tagged | +Inquiry |
PTH-7002C | Recombinant Chicken PTH | +Inquiry |
PTH-02H | Recombinant Human PTH protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTH-1273HCL | Recombinant Human PTH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTH Products
Required fields are marked with *
My Review for All PTH Products
Required fields are marked with *
0
Inquiry Basket