Recombinant Human PTH protein, 15N Stable Isotope Labeled

Cat.No. : PTH-152H
Product Overview : Recombinant Human PTH protein (7-84 a.a., 15N stable isotope labeled) was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 78
Description : This gene encodes a member of the parathyroid family of proteins. The encoded preproprotein is proteolytically processed to generate a protein that binds to the parathyroid hormone/parathyroid hormone-related peptide receptor and regulates blood calcium and phosphate levels. Excess production of the encoded protein, known as hyperparathyroidism, can result in hypercalcemia and kidney stones. On the other hand, defective processing of the encoded protein may lead to hypoparathyroidism, which can result in hypocalcemia and numbness. Alternative splicing results in multiple transcript variants.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Molecular Mass : Approximately 8900 Da, a single non-glycosylated polypeptide chain containing 78 amino acids. 15N stable isotope labeled.
AA Sequence : LMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Endotoxin : Less than 0.1 EU/μg of rHuPTH7-84, 15N as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Conjugation : 15N Stable Isotope
Gene Name PTH
Official Symbol PTH
Synonyms PTH; parathyroid hormone; parathormone; parathyrin; parathyroid hormone 1; PTH1;
Gene ID 5741
mRNA Refseq NM_000315
Protein Refseq NP_000306
MIM 168450
UniProt ID P01270

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTH Products

Required fields are marked with *

My Review for All PTH Products

Required fields are marked with *

0
cart-icon
0
compare icon