Recombinant Human PTH therapeutic protein (Teriparatide)

• Cat.No.: PTH-P062H
• Product Overview: Recombinant human parathyroid hormone is a potent anabolic agent used in the treatment of osteoporosis.

Specification

• Species: Human
• Tag: Non
• Protein Length: 34 Aa
• Description: Our expression product is the active ingredient of Apthela, Forsteo, Forteo, Fortessa, Opthia, Optia, Optiah, Zalectra and Zelletra.
• Molecular Mass: 4.12 Kda
• AA Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
• Endotoxin: < 1.0 EU per μg of the protein
• Purity: >95%
• Storage: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
• Alias: PTH; PTH1; PTH (1-34); PTH 1-34; Teriparatida; Teriparatide recombinant human

Gene Information

• Gene Name: PTH parathyroid hormone [ Homo sapiens ]
• Official Symbol: PTH
• Synonyms: PTH; parathyroid hormone; parathormone; parathyrin; parathyroid hormone 1; PTH1
• Gene ID: 5741
• mRNA Refseq: NM_000315
• Protein Refseq: NP_000306
• MIM: 168450
• UniProt ID: P01270
• Chromosome Location: 11p15.3-p15.1
• Pathway: Class B/2 (Secretin family receptors), organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Osteoblast Signaling, organism-specific biosystem; Signal Transduction, organism-specific biosystem
• Function: hormone activity; parathyroid hormone receptor binding; peptide hormone receptor binding; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity