Recombinant Human PTH therapeutic protein (Teriparatide)
Cat.No. : | PTH-P062H |
Product Overview : | Recombinant human parathyroid hormone is a potent anabolic agent used in the treatment of osteoporosis. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 34 Aa |
Description : | Our expression product is the active ingredient of Apthela, Forsteo, Forteo, Fortessa, Opthia, Optia, Optiah, Zalectra and Zelletra. |
Molecular Mass : | 4.12 Kda |
AA Sequence : | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
Endotoxin : | < 1.0 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Alias : | PTH; PTH1; PTH (1-34); PTH 1-34; Teriparatida; Teriparatide recombinant human |
Gene Name | PTH parathyroid hormone [ Homo sapiens ] |
Official Symbol | PTH |
Synonyms | PTH; parathyroid hormone; parathormone; parathyrin; parathyroid hormone 1; PTH1; |
Gene ID | 5741 |
mRNA Refseq | NM_000315 |
Protein Refseq | NP_000306 |
MIM | 168450 |
UniProt ID | P01270 |
Chromosome Location | 11p15.3-p15.1 |
Pathway | Class B/2 (Secretin family receptors), organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Osteoblast Signaling, organism-specific biosystem; Signal Transduction, organism-specific biosystem; |
Function | hormone activity; parathyroid hormone receptor binding; peptide hormone receptor binding; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; |
◆ Recombinant Proteins | ||
PTH-3266H | Recombinant Human PTH protein, His-tagged | +Inquiry |
Pth-5859R | Recombinant Rat Pth protein, His&Myc-tagged | +Inquiry |
PTH-503H | Recombinant Human PTH Protein, GST-tagged | +Inquiry |
PTH-190H | Recombinant Human Parathyroid Hormone, Fc Chimera | +Inquiry |
PTH-02H | Recombinant Human PTH protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTH-1273HCL | Recombinant Human PTH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTH Products
Required fields are marked with *
My Review for All PTH Products
Required fields are marked with *
0
Inquiry Basket