Recombinant Human PTHLH protein, His/S-tagged

Cat.No. : PTHLH-113H
Product Overview : Recombinant Human PTHLH protein (Ala37-His177), fused to His/S-tag at N-terminus, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&S
Protein Length : 193
Description : The protein encoded by this gene is a member of the parathyroid hormone family. This hormone, via its receptor, PTHR1, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is responsible for most cases of humoral hypercalcemia of malignancy, and mutations in this gene are associated with brachydactyly type E2 (BDE2). Alternatively spliced transcript variants have been found for this gene. There is also evidence for alternative translation initiation from non-AUG (CUG and GUG) start sites, downstream of the initiator AUG codon, resulting in nuclear forms of this hormone.
Form : Supplied as lyophilized form in PBS, pH7.4, containing 1mM DTT, 5% trehalose, 0.01% sarcosyl and preservative.
Molecular Mass : 21.7kDa
AA Sequence : MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEFAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH
Endotoxin : <1.0 EU per 1µg (determined by the LAL method).
Purity : >95%
Applications : SDS-PAGE; WB; ELISA; IP.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months.
Reconstitution : Reconstitute in sterile PBS, pH7.2 - pH7.4.
Gene Name PTHLH
Official Symbol PTHLH
Synonyms HHM; PLP; BDE2; PTHR; PTHRP
Gene ID 5744
mRNA Refseq NM_198965.2
Protein Refseq NP_945316.1
MIM 168470
UniProt ID P12272

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTHLH Products

Required fields are marked with *

My Review for All PTHLH Products

Required fields are marked with *

0
cart-icon